Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | A1D33_RS16815 | Genome accession | NZ_CP015443 |
| Coordinates | 3533822..3533995 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CC09 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3528822..3538995
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A1D33_RS16765 (A1D33_016760) | comGD | 3528942..3529379 (+) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| A1D33_RS16770 (A1D33_016765) | comGE | 3529363..3529677 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| A1D33_RS16775 (A1D33_016770) | comGF | 3529586..3530086 (+) | 501 | WP_257738552.1 | competence type IV pilus minor pilin ComGF | - |
| A1D33_RS16780 (A1D33_016775) | comGG | 3530087..3530464 (+) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| A1D33_RS16785 (A1D33_016780) | - | 3530521..3530700 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| A1D33_RS16790 (A1D33_016785) | - | 3530740..3531069 (-) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| A1D33_RS16795 (A1D33_016790) | tapA | 3531328..3531999 (+) | 672 | WP_031378945.1 | amyloid fiber anchoring/assembly protein TapA | - |
| A1D33_RS16800 (A1D33_016795) | sipW | 3531971..3532555 (+) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| A1D33_RS16805 (A1D33_016800) | tasA | 3532620..3533405 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| A1D33_RS16810 (A1D33_016805) | sinR | 3533453..3533788 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| A1D33_RS16815 (A1D33_016810) | sinI | 3533822..3533995 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| A1D33_RS16820 (A1D33_016815) | - | 3534172..3534966 (-) | 795 | WP_007408330.1 | YqhG family protein | - |
| A1D33_RS16825 (A1D33_016820) | - | 3534988..3536658 (-) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| A1D33_RS16830 (A1D33_016825) | gcvT | 3537082..3538182 (+) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=179884 A1D33_RS16815 WP_003153105.1 3533822..3533995(-) (sinI) [Bacillus velezensis strain CC09]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=179884 A1D33_RS16815 WP_003153105.1 3533822..3533995(-) (sinI) [Bacillus velezensis strain CC09]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |