Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   A2I97_RS11800 Genome accession   NZ_CP014990
Coordinates   2442746..2443123 (-) Length   125 a.a.
NCBI ID   WP_070082110.1    Uniprot ID   -
Organism   Bacillus velezensis strain KD1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2437746..2448123
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A2I97_RS11760 (A2I97_11395) - 2438245..2439039 (+) 795 WP_014305407.1 YqhG family protein -
  A2I97_RS11765 (A2I97_11400) sinI 2439216..2439389 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  A2I97_RS11770 (A2I97_11405) sinR 2439423..2439758 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  A2I97_RS11775 (A2I97_11410) tasA 2439806..2440591 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  A2I97_RS11780 (A2I97_11415) sipW 2440655..2441239 (-) 585 WP_012117977.1 signal peptidase I SipW -
  A2I97_RS11785 (A2I97_11420) tapA 2441211..2441882 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  A2I97_RS11790 (A2I97_11425) - 2442141..2442470 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  A2I97_RS11795 (A2I97_11430) - 2442510..2442689 (-) 180 WP_003153093.1 YqzE family protein -
  A2I97_RS11800 (A2I97_11435) comGG 2442746..2443123 (-) 378 WP_070082110.1 competence type IV pilus minor pilin ComGG Machinery gene
  A2I97_RS11805 (A2I97_11440) comGF 2443124..2443519 (-) 396 WP_070082111.1 competence type IV pilus minor pilin ComGF -
  A2I97_RS11810 (A2I97_11445) comGE 2443533..2443847 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  A2I97_RS11815 (A2I97_11450) comGD 2443831..2444268 (-) 438 WP_070082112.1 competence type IV pilus minor pilin ComGD Machinery gene
  A2I97_RS11820 (A2I97_11455) comGC 2444258..2444566 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  A2I97_RS11825 (A2I97_11460) comGB 2444571..2445608 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  A2I97_RS11830 (A2I97_11465) comGA 2445595..2446665 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  A2I97_RS11835 (A2I97_11470) - 2446857..2447807 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14173.10 Da        Isoelectric Point: 9.8061

>NTDB_id=175778 A2I97_RS11800 WP_070082110.1 2442746..2443123(-) (comGG) [Bacillus velezensis strain KD1]
MHKSDGFIYPAILFVSAAVLFVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=175778 A2I97_RS11800 WP_070082110.1 2442746..2443123(-) (comGG) [Bacillus velezensis strain KD1]
ATGCACAAATCTGACGGTTTTATATATCCCGCGATTCTGTTTGTTTCTGCCGCAGTTTTATTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGCGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment