Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | A2I97_RS11765 | Genome accession | NZ_CP014990 |
| Coordinates | 2439216..2439389 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain KD1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2434216..2444389
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A2I97_RS11750 (A2I97_11385) | gcvT | 2435033..2436133 (-) | 1101 | WP_070082107.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| A2I97_RS11755 (A2I97_11390) | - | 2436557..2438227 (+) | 1671 | WP_070082108.1 | DEAD/DEAH box helicase | - |
| A2I97_RS11760 (A2I97_11395) | - | 2438245..2439039 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| A2I97_RS11765 (A2I97_11400) | sinI | 2439216..2439389 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| A2I97_RS11770 (A2I97_11405) | sinR | 2439423..2439758 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| A2I97_RS11775 (A2I97_11410) | tasA | 2439806..2440591 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| A2I97_RS11780 (A2I97_11415) | sipW | 2440655..2441239 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| A2I97_RS11785 (A2I97_11420) | tapA | 2441211..2441882 (-) | 672 | WP_070082109.1 | amyloid fiber anchoring/assembly protein TapA | - |
| A2I97_RS11790 (A2I97_11425) | - | 2442141..2442470 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| A2I97_RS11795 (A2I97_11430) | - | 2442510..2442689 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| A2I97_RS11800 (A2I97_11435) | comGG | 2442746..2443123 (-) | 378 | WP_070082110.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| A2I97_RS11805 (A2I97_11440) | comGF | 2443124..2443519 (-) | 396 | WP_070082111.1 | competence type IV pilus minor pilin ComGF | - |
| A2I97_RS11810 (A2I97_11445) | comGE | 2443533..2443847 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| A2I97_RS11815 (A2I97_11450) | comGD | 2443831..2444268 (-) | 438 | WP_070082112.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=175776 A2I97_RS11765 WP_003153105.1 2439216..2439389(+) (sinI) [Bacillus velezensis strain KD1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=175776 A2I97_RS11765 WP_003153105.1 2439216..2439389(+) (sinI) [Bacillus velezensis strain KD1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |