Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   APV63_RS00200 Genome accession   NZ_CP012905
Coordinates   37578..37691 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 7C     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32578..42691
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  APV63_RS00175 (APV63_00170) - 32640..34865 (+) 2226 WP_060472758.1 AAA family ATPase -
  APV63_RS00180 (APV63_00175) panD 34855..35208 (+) 354 WP_060472759.1 aspartate 1-decarboxylase -
  APV63_RS00185 (APV63_00180) - 35211..35504 (+) 294 WP_000347915.1 YbaB/EbfC family nucleoid-associated protein -
  APV63_RS00190 (APV63_00185) - 35504..36499 (+) 996 WP_060472760.1 PDZ domain-containing protein -
  APV63_RS00195 (APV63_00190) comB6 36507..37562 (+) 1056 WP_060472761.1 type IV secretion system protein Machinery gene
  APV63_RS00200 (APV63_00195) comB7 37578..37691 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  APV63_RS00205 (APV63_00200) comB8 37688..38431 (+) 744 WP_060472762.1 type IV secretion system protein Machinery gene
  APV63_RS00210 (APV63_00205) comB9 38431..39408 (+) 978 WP_060472763.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  APV63_RS00215 (APV63_00210) comB10 39401..40537 (+) 1137 WP_060472764.1 DNA type IV secretion system protein ComB10 Machinery gene
  APV63_RS00220 (APV63_00215) - 40607..42019 (+) 1413 WP_060472765.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=158164 APV63_RS00200 WP_001217873.1 37578..37691(+) (comB7) [Helicobacter pylori strain 7C]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=158164 APV63_RS00200 WP_001217873.1 37578..37691(+) (comB7) [Helicobacter pylori strain 7C]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACTTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment