Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLUC11_RS10805 Genome accession   NZ_CP015904
Coordinates   2192117..2192401 (-) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain UC11     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2187117..2197401
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC11_RS10775 (LLUC11_2081) - 2187557..2187934 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLUC11_RS10780 (LLUC11_2082) - 2188139..2189005 (+) 867 WP_025017140.1 RluA family pseudouridine synthase -
  LLUC11_RS10785 (LLUC11_2083) - 2189043..2189852 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLUC11_RS10790 (LLUC11_2084) - 2189845..2190582 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLUC11_RS10795 (LLUC11_2085) - 2190759..2191601 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LLUC11_RS10800 (LLUC11_2086) - 2191598..2192035 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LLUC11_RS10805 (LLUC11_2087) comGG 2192117..2192401 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC11_RS10810 (LLUC11_2088) comGF 2192440..2192886 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC11_RS10815 (LLUC11_2089) comGE 2192849..2193145 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC11_RS10820 (LLUC11_2090) comGD 2193235..2193534 (-) 300 WP_289667678.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  LLUC11_RS10825 (LLUC11_2091) comGC 2193509..2193892 (-) 384 WP_081040674.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC11_RS10830 (LLUC11_2092) comGB 2193906..2194979 (-) 1074 WP_081041295.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUC11_RS10835 (LLUC11_2093) comGA 2194873..2195811 (-) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=156010 LLUC11_RS10805 WP_025017139.1 2192117..2192401(-) (comGG) [Lactococcus lactis subsp. lactis strain UC11]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=156010 LLUC11_RS10805 WP_025017139.1 2192117..2192401(-) (comGG) [Lactococcus lactis subsp. lactis strain UC11]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585