Detailed information NTG0150145

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: BaDB11_RS04180
• Genome accession: NZ_CP014795
• Coordinates: 745466..745903 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain SCK B11
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 740466..750903

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BaDB11_RS04130 (BaDB11_00839)	sinI	740641..740817 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
BaDB11_RS04135 (BaDB11_00840)	sinR	740851..741186 (+)	336	WP_025804940.1	transcriptional regulator SinR	Regulator
BaDB11_RS04140 (BaDB11_00841)	tasA	741291..742085 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
BaDB11_RS04145 (BaDB11_00842)	sipW	742159..742743 (-)	585	WP_003183449.1	signal peptidase I SipW	-
BaDB11_RS04150 (BaDB11_00843)	tapA	742740..743468 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
BaDB11_RS04155 (BaDB11_00844)	-	743745..744065 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
BaDB11_RS04160 (BaDB11_00845)	-	744089..744271 (-)	183	WP_003183456.1	YqzE family protein	-
BaDB11_RS04165 (BaDB11_00846)	comGG	744360..744725 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
BaDB11_RS04170 (BaDB11_00847)	comGF	744738..745226 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
BaDB11_RS04175	comGE	745135..745482 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
BaDB11_RS04180 (BaDB11_00848)	comGD	745466..745903 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
BaDB11_RS04185 (BaDB11_00849)	comGC	745909..746202 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
BaDB11_RS04190 (BaDB11_00850)	comGB	746216..747250 (-)	1035	WP_075218359.1	competence type IV pilus assembly protein ComGB	Machinery gene
BaDB11_RS04195 (BaDB11_00851)	comGA	747240..748304 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
BaDB11_RS04200 (BaDB11_00852)	-	748461..749300 (-)	840	WP_003183480.1	STAS domain-containing protein	-
BaDB11_RS04210	-	749558..749917 (-)	360	Protein_845	Spx/MgsR family RNA polymerase-binding regulatory protein	-
BaDB11_RS04215 (BaDB11_00854)	-	750126..750371 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=150145 BaDB11_RS04180 WP_009327905.1 745466..745903(-) (comGD) [Bacillus licheniformis strain SCK B11]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=150145 BaDB11_RS04180 WP_009327905.1 745466..745903(-) (comGD) [Bacillus licheniformis strain SCK B11]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393