Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   AA974_RS00065 Genome accession   NZ_CP011487
Coordinates   11620..11733 (+) Length   37 a.a.
NCBI ID   WP_001217871.1    Uniprot ID   -
Organism   Helicobacter pylori strain PNG84A     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 6620..16733
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AA974_RS00040 (AA974_00045) - 6685..8907 (+) 2223 WP_064432888.1 AAA family ATPase -
  AA974_RS00045 (AA974_00050) panD 8897..9247 (+) 351 WP_064432889.1 aspartate 1-decarboxylase -
  AA974_RS00050 (AA974_00055) - 9258..9551 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  AA974_RS00055 (AA974_00060) - 9551..10546 (+) 996 WP_064432890.1 PDZ domain-containing protein -
  AA974_RS00060 (AA974_00065) comB6 10552..11604 (+) 1053 WP_064434028.1 P-type conjugative transfer protein TrbL Machinery gene
  AA974_RS00065 (AA974_00070) comB7 11620..11733 (+) 114 WP_001217871.1 hypothetical protein Machinery gene
  AA974_RS00070 (AA974_00075) comB8 11730..12473 (+) 744 WP_064432891.1 type IV secretion system protein Machinery gene
  AA974_RS00075 (AA974_00080) comB9 12473..13432 (+) 960 WP_064432892.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  AA974_RS00080 (AA974_00085) comB10 13425..14561 (+) 1137 WP_064432893.1 DNA type IV secretion system protein ComB10 Machinery gene
  AA974_RS00085 (AA974_00090) - 14631..16049 (+) 1419 WP_064432894.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=146291 AA974_RS00065 WP_001217871.1 11620..11733(+) (comB7) [Helicobacter pylori strain PNG84A]
MRIFFVIMGLMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=146291 AA974_RS00065 WP_001217871.1 11620..11733(+) (comB7) [Helicobacter pylori strain PNG84A]
ATGAGAATTTTTTTTGTTATTATGGGACTCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946

Multiple sequence alignment