Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   AA973_RS07335 Genome accession   NZ_CP011485
Coordinates   36849..36962 (+) Length   37 a.a.
NCBI ID   WP_001217871.1    Uniprot ID   -
Organism   Helicobacter pylori strain ausabrJ05     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 31849..41962
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AA973_RS00180 (AA973_00175) - 31909..34131 (+) 2223 WP_064437125.1 AAA family ATPase -
  AA973_RS00185 (AA973_00180) panD 34121..34471 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  AA973_RS00190 (AA973_00185) - 34482..34775 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  AA973_RS00195 (AA973_00190) - 34775..35770 (+) 996 WP_064437126.1 PDZ domain-containing protein -
  AA973_RS00200 (AA973_00195) comB6 35778..36833 (+) 1056 WP_064437127.1 P-type conjugative transfer protein TrbL Machinery gene
  AA973_RS07335 comB7 36849..36962 (+) 114 WP_001217871.1 hypothetical protein Machinery gene
  AA973_RS00205 (AA973_00200) comB8 36959..37702 (+) 744 WP_064437128.1 type IV secretion system protein Machinery gene
  AA973_RS00210 (AA973_00205) comB9 37702..38664 (+) 963 WP_064437129.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  AA973_RS00215 (AA973_00210) comB10 38657..39793 (+) 1137 WP_064437130.1 DNA type IV secretion system protein ComB10 Machinery gene
  AA973_RS00220 (AA973_00215) - 39863..41281 (+) 1419 WP_064437131.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=146267 AA973_RS07335 WP_001217871.1 36849..36962(+) (comB7) [Helicobacter pylori strain ausabrJ05]
MRIFFVIMGLMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=146267 AA973_RS07335 WP_001217871.1 36849..36962(+) (comB7) [Helicobacter pylori strain ausabrJ05]
ATGAGAATATTTTTTGTTATTATGGGACTCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946


Multiple sequence alignment