Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   EE66_RS06405 Genome accession   NZ_CP011483
Coordinates   1308030..1308155 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain DU15     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1303030..1313155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EE66_RS06385 (EE66_06380) - 1303736..1305139 (-) 1404 WP_064431614.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  EE66_RS06390 (EE66_06385) comB10 1305205..1306341 (-) 1137 WP_064431377.1 DNA type IV secretion system protein ComB10 Machinery gene
  EE66_RS06395 (EE66_06390) comB9 1306334..1307296 (-) 963 WP_064431378.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EE66_RS06400 (EE66_06395) comB8 1307296..1308033 (-) 738 WP_064431379.1 virB8 family protein Machinery gene
  EE66_RS06405 (EE66_06400) comB7 1308030..1308155 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  EE66_RS06410 (EE66_06405) comB6 1308171..1309226 (-) 1056 WP_064431380.1 P-type conjugative transfer protein TrbL Machinery gene
  EE66_RS06415 (EE66_06410) - 1309234..1310229 (-) 996 WP_064431381.1 PDZ domain-containing protein -
  EE66_RS06420 (EE66_06415) - 1310229..1310522 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  EE66_RS06425 (EE66_06420) panD 1310533..1310883 (-) 351 WP_064431382.1 aspartate 1-decarboxylase -
  EE66_RS06430 (EE66_06425) - 1310873..1313098 (-) 2226 WP_064431383.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=146219 EE66_RS06405 WP_001217874.1 1308030..1308155(-) (comB7) [Helicobacter pylori strain DU15]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=146219 EE66_RS06405 WP_001217874.1 1308030..1308155(-) (comB7) [Helicobacter pylori strain DU15]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAACCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment