Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | SMQ301_RS12215 | Genome accession | NZ_CP011217 |
| Coordinates | 274606..274815 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain SMQ-301 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 269606..279815
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMQ301_RS01535 (SMQ301_0269) | - | 270015..270554 (+) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| SMQ301_RS01540 (SMQ301_0270) | - | 270865..271422 (+) | 558 | WP_011680718.1 | ECF transporter S component | - |
| SMQ301_RS01545 (SMQ301_0271) | - | 271425..272075 (+) | 651 | WP_011680719.1 | phosphatase PAP2 family protein | - |
| SMQ301_RS01550 (SMQ301_0272) | comR | 272270..273169 (+) | 900 | WP_011680720.1 | helix-turn-helix domain-containing protein | Regulator |
| SMQ301_RS12205 (SMQ301_0274) | - | 273407..273988 (+) | 582 | Protein_243 | cysteine peptidase family C39 domain-containing protein | - |
| SMQ301_RS12210 (SMQ301_0275) | comA | 273973..274263 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| SMQ301_RS12215 (SMQ301_0277) | comA | 274606..274815 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| SMQ301_RS01570 (SMQ301_0279) | - | 274870..275438 (+) | 569 | Protein_246 | ATP-binding cassette domain-containing protein | - |
| SMQ301_RS12220 (SMQ301_0280) | - | 275669..275857 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| SMQ301_RS12230 (SMQ301_0282) | - | 276350..276652 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| SMQ301_RS12235 (SMQ301_0283) | - | 276876..277247 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| SMQ301_RS01585 (SMQ301_0284) | - | 277653..278168 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| SMQ301_RS01590 (SMQ301_0285) | - | 278193..278495 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| SMQ301_RS01595 (SMQ301_0286) | - | 278507..278818 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=143658 SMQ301_RS12215 WP_002946147.1 274606..274815(+) (comA) [Streptococcus thermophilus strain SMQ-301]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=143658 SMQ301_RS12215 WP_002946147.1 274606..274815(+) (comA) [Streptococcus thermophilus strain SMQ-301]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |