Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   F384_RS22375 Genome accession   NZ_CP011132
Coordinates   4845521..4846048 (+) Length   175 a.a.
NCBI ID   WP_046493925.1    Uniprot ID   -
Organism   Citrobacter amalonaticus Y19     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4845521..4888598 4845521..4846048 within 0


Gene organization within MGE regions


Location: 4845521..4888598
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F384_RS22375 (F384_22375) ssb 4845521..4846048 (+) 528 WP_046493925.1 single-stranded DNA-binding protein SSB1 Machinery gene
  F384_RS22380 (F384_22380) - 4846306..4846866 (-) 561 WP_003030312.1 recombinase family protein -
  F384_RS22385 (F384_22385) - 4847072..4847494 (+) 423 WP_003030314.1 hypothetical protein -
  F384_RS30505 - 4847592..4847885 (+) 294 WP_226991612.1 hypothetical protein -
  F384_RS22390 (F384_22390) - 4847887..4848318 (+) 432 WP_046493926.1 tail fiber assembly protein -
  F384_RS22395 (F384_22395) - 4848290..4848883 (-) 594 WP_046493927.1 tail fiber assembly protein -
  F384_RS28125 - 4848883..4849770 (-) 888 WP_052746974.1 hypothetical protein -
  F384_RS22405 (F384_22405) - 4849770..4850342 (-) 573 WP_046493928.1 YmfQ family protein -
  F384_RS22410 (F384_22410) - 4850339..4851406 (-) 1068 WP_046493929.1 baseplate J/gp47 family protein -
  F384_RS22415 (F384_22415) - 4851406..4851756 (-) 351 WP_046493930.1 phage GP46 family protein -
  F384_RS22420 (F384_22420) - 4851848..4852435 (-) 588 WP_046493931.1 phage baseplate assembly protein V -
  F384_RS22425 (F384_22425) - 4852419..4853645 (-) 1227 WP_046493932.1 phage baseplate assembly protein -
  F384_RS22430 (F384_22430) - 4853629..4854960 (-) 1332 WP_046493933.1 DNA circularization protein -
  F384_RS22435 (F384_22435) - 4854957..4857167 (-) 2211 WP_046493934.1 phage tail tape measure protein -
  F384_RS30645 - 4857171..4857305 (-) 135 WP_264371171.1 hypothetical protein -
  F384_RS22440 (F384_22440) - 4857302..4857694 (-) 393 WP_046493935.1 hypothetical protein -
  F384_RS22445 (F384_22445) - 4857695..4858069 (-) 375 WP_046493936.1 hypothetical protein -
  F384_RS22450 (F384_22450) - 4858083..4859501 (-) 1419 WP_046493937.1 phage tail sheath C-terminal domain-containing protein -
  F384_RS22455 (F384_22455) - 4859488..4859706 (-) 219 WP_046493938.1 DUF2635 domain-containing protein -
  F384_RS22460 (F384_22460) - 4859693..4860352 (-) 660 WP_046493939.1 DUF1834 family protein -
  F384_RS22465 (F384_22465) - 4860352..4860780 (-) 429 WP_046493940.1 gp436 family protein -
  F384_RS22470 (F384_22470) - 4860784..4861239 (-) 456 WP_046493941.1 HI1506-related protein -
  F384_RS22475 (F384_22475) - 4861239..4862147 (-) 909 WP_046493942.1 Mu-like prophage major head subunit gpT family protein -
  F384_RS22480 (F384_22480) - 4862159..4862551 (-) 393 WP_046493943.1 hypothetical protein -
  F384_RS22485 (F384_22485) - 4862563..4863660 (-) 1098 WP_046493944.1 phage protease -
  F384_RS22490 (F384_22490) - 4863883..4864425 (-) 543 WP_046493945.1 phage virion morphogenesis protein -
  F384_RS22495 (F384_22495) - 4864422..4865681 (-) 1260 WP_046493946.1 phage minor head protein -
  F384_RS22500 (F384_22500) - 4865668..4867245 (-) 1578 WP_046493947.1 DUF935 domain-containing protein -
  F384_RS22505 (F384_22505) terL 4867249..4868904 (-) 1656 WP_046493948.1 phage terminase large subunit -
  F384_RS22510 (F384_22510) - 4868909..4869268 (-) 360 WP_046493949.1 hypothetical protein -
  F384_RS22515 (F384_22515) - 4869265..4869498 (-) 234 WP_046493950.1 hypothetical protein -
  F384_RS22520 (F384_22520) - 4869491..4869991 (-) 501 WP_046493951.1 DUF1804 family protein -
  F384_RS22525 (F384_22525) - 4869993..4870277 (-) 285 WP_046493952.1 hypothetical protein -
  F384_RS22530 (F384_22530) - 4870274..4870516 (-) 243 WP_046493953.1 hypothetical protein -
  F384_RS22535 (F384_22535) - 4870525..4871157 (-) 633 WP_046493954.1 hypothetical protein -
  F384_RS30140 - 4871129..4871380 (-) 252 WP_080950011.1 DUF2644 domain-containing protein -
  F384_RS22540 (F384_22540) - 4871377..4872021 (-) 645 WP_046493955.1 glycoside hydrolase family 19 protein -
  F384_RS22545 (F384_22545) - 4872100..4872600 (-) 501 WP_046493956.1 hypothetical protein -
  F384_RS22550 (F384_22550) - 4872613..4873047 (-) 435 WP_046493957.1 Mor transcription activator family protein -
  F384_RS22555 (F384_22555) - 4872992..4873468 (-) 477 WP_046493958.1 gp16 family protein -
  F384_RS30035 (F384_22560) - 4873703..4873921 (-) 219 WP_052746975.1 hypothetical protein -
  F384_RS22565 (F384_22565) - 4873918..4874133 (-) 216 WP_046493959.1 hypothetical protein -
  F384_RS22570 (F384_22570) - 4874126..4874491 (-) 366 WP_046493960.1 DUF4406 domain-containing protein -
  F384_RS22575 (F384_22575) - 4874488..4874991 (-) 504 WP_052746976.1 hypothetical protein -
  F384_RS22580 (F384_22580) - 4874988..4875710 (-) 723 WP_046493961.1 DUF2786 domain-containing protein -
  F384_RS28130 - 4875715..4876164 (-) 450 WP_155404029.1 hypothetical protein -
  F384_RS22590 (F384_22590) - 4876242..4876433 (-) 192 WP_046493962.1 hypothetical protein -
  F384_RS22595 (F384_22595) - 4876414..4876656 (-) 243 WP_046493963.1 ANR family transcriptional regulator -
  F384_RS22600 (F384_22600) - 4876658..4877302 (-) 645 WP_046493964.1 DUF3164 family protein -
  F384_RS22605 (F384_22605) - 4877292..4877489 (-) 198 WP_046493965.1 hypothetical protein -
  F384_RS22610 (F384_22610) - 4877491..4877712 (-) 222 WP_052746978.1 hypothetical protein -
  F384_RS22615 (F384_22615) - 4877723..4878013 (-) 291 WP_046493966.1 hypothetical protein -
  F384_RS22620 (F384_22620) - 4878024..4878917 (-) 894 WP_046493967.1 AAA family ATPase -
  F384_RS22625 (F384_22625) - 4878925..4880979 (-) 2055 WP_046493968.1 Mu transposase C-terminal domain-containing protein -
  F384_RS22630 (F384_22630) - 4881002..4881271 (-) 270 WP_046493969.1 helix-turn-helix domain-containing protein -
  F384_RS22635 (F384_22635) - 4881397..4882182 (+) 786 WP_226991613.1 helix-turn-helix transcriptional regulator -
  F384_RS22640 (F384_22640) - 4882544..4885261 (-) 2718 WP_413541461.1 cation-transporting P-type ATPase -
  F384_RS22645 (F384_22645) - 4885809..4886090 (-) 282 WP_042999048.1 YjcB family protein -
  F384_RS22650 (F384_22650) - 4886686..4888272 (+) 1587 WP_046493971.1 EAL domain-containing protein -
  F384_RS22655 (F384_22655) soxS 4888275..4888598 (-) 324 WP_046493972.1 superoxide response transcriptional regulator SoxS -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 18907.95 Da        Isoelectric Point: 5.2456

>NTDB_id=142661 F384_RS22375 WP_046493925.1 4845521..4846048(+) (ssb) [Citrobacter amalonaticus Y19]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGVEKYTTEVVVNVGGTMQMLGGRQGGGAPAGGQQQQGSWGQPQQPQGGNQFSGGAQSRPQQQSAPAA
PSNEPPMDFDDDIPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=142661 F384_RS22375 WP_046493925.1 4845521..4846048(+) (ssb) [Citrobacter amalonaticus Y19]
ATGGCCAGCAGAGGCGTAAATAAGGTTATTCTCGTGGGTAATCTGGGCCAGGACCCGGAAGTACGCTACATGCCGAATGG
TGGCGCTGTCGCCAACATCACGCTGGCTACTTCCGAATCCTGGCGTGACAAGCAGACCGGCGAGATGAAAGAGCAGACGG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCGGAAGTGGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTCTACATT
GAAGGTCAGCTGCGTACCCGCAAATGGACCGATCAGTCCGGCGTTGAAAAATACACCACGGAAGTGGTGGTGAACGTGGG
CGGCACCATGCAAATGCTGGGTGGCCGTCAGGGTGGCGGCGCACCGGCTGGTGGTCAGCAGCAGCAGGGCAGTTGGGGTC
AGCCTCAGCAGCCACAGGGCGGTAACCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGCAGTCTGCACCGGCAGCG
CCGTCCAATGAACCGCCGATGGATTTTGACGACGATATCCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

74.033

100

0.766

  ssb Glaesserella parasuis strain SC1401

57.609

100

0.606

  ssb Neisseria meningitidis MC58

47.778

100

0.491

  ssb Neisseria gonorrhoeae MS11

47.778

100

0.491

  ssbA Bacillus subtilis subsp. subtilis str. 168

36.111

100

0.371


Multiple sequence alignment