Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LG36_RS10775 Genome accession   NZ_CP009472
Coordinates   2226275..2226550 (-) Length   91 a.a.
NCBI ID   WP_021721873.1    Uniprot ID   -
Organism   Lactococcus lactis strain AI06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2221275..2231550
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LG36_RS10745 (LG36_2052) - 2221716..2222093 (-) 378 WP_038602343.1 pyridoxamine 5'-phosphate oxidase family protein -
  LG36_RS10750 (LG36_2053) - 2222298..2223164 (+) 867 WP_038602346.1 RluA family pseudouridine synthase -
  LG36_RS10755 (LG36_2054) - 2223202..2224011 (-) 810 WP_038602349.1 metal ABC transporter permease -
  LG36_RS10760 (LG36_2055) - 2224004..2224741 (-) 738 WP_021723055.1 metal ABC transporter ATP-binding protein -
  LG36_RS10765 (LG36_2056) - 2224918..2225760 (-) 843 WP_038602352.1 metal ABC transporter substrate-binding protein -
  LG36_RS10770 (LG36_2057) - 2225757..2226194 (-) 438 WP_021721874.1 zinc-dependent MarR family transcriptional regulator -
  LG36_RS10775 (LG36_2058) comGG 2226275..2226550 (-) 276 WP_021721873.1 hypothetical protein Machinery gene
  LG36_RS10780 (LG36_2059) comGF 2226598..2227044 (-) 447 WP_021721872.1 competence type IV pilus minor pilin ComGF Machinery gene
  LG36_RS10785 (LG36_2060) comGE 2227007..2227303 (-) 297 WP_038602356.1 competence type IV pilus minor pilin ComGE Machinery gene
  LG36_RS10790 (LG36_2061) comGD 2227275..2227706 (-) 432 WP_080651959.1 competence type IV pilus minor pilin ComGD Machinery gene
  LG36_RS10795 (LG36_2062) comGC 2227666..2228049 (-) 384 WP_080739889.1 competence type IV pilus major pilin ComGC Machinery gene
  LG36_RS10800 (LG36_2063) comGB 2228063..2229136 (-) 1074 WP_080739890.1 competence type IV pilus assembly protein ComGB Machinery gene
  LG36_RS10805 (LG36_2064) comGA 2229030..2229968 (-) 939 WP_038602362.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 91 a.a.        Molecular weight: 10539.79 Da        Isoelectric Point: 5.6623

>NTDB_id=129659 LG36_RS10775 WP_021721873.1 2226275..2226550(-) (comGG) [Lactococcus lactis strain AI06]
MFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLFYNLLTDSSASSKTTDHLSDEKTYQFSIR
LKDGTNFQIKN

Nucleotide


Download         Length: 276 bp        

>NTDB_id=129659 LG36_RS10775 WP_021721873.1 2226275..2226550(-) (comGG) [Lactococcus lactis strain AI06]
ATGTTTCTTCAGTTCTATTTGCAAAGACAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTTAACTGCTGA
ATTAATGGTGTCAGTAGCTTTAAAGACTGACTTAAAATCTCAAGGGCAAATTCATTTTGATTCAGGAGATTTGTTCTACA
ATTTACTGACAGACTCGTCAGCCAGTTCAAAAACTACTGATCATTTAAGCGATGAAAAAACTTATCAATTTAGTATCCGC
CTAAAAGATGGCACAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

61.111

98.901

0.604

Multiple sequence alignment