Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   IX83_RS06960 Genome accession   NZ_CP009238
Coordinates   1623275..1623754 (+) Length   159 a.a.
NCBI ID   WP_038500706.1    Uniprot ID   A0A077DE37
Organism   Basilea psittacipulmonis DSM 24701     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1586741..1636697 1623275..1623754 within 0


Gene organization within MGE regions


Location: 1586741..1636697
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IX83_RS06760 (IX83_06995) - 1586741..1587595 (+) 855 WP_038500630.1 DMT family transporter -
  IX83_RS06765 (IX83_07000) - 1587677..1587982 (-) 306 WP_201770273.1 HigA family addiction module antitoxin -
  IX83_RS09120 - 1587989..1588069 (-) 81 Protein_1321 Killer protein -
  IX83_RS06775 (IX83_07010) - 1588561..1588962 (-) 402 WP_038500639.1 hypothetical protein -
  IX83_RS06780 - 1588964..1589461 (-) 498 WP_051919473.1 TIGR02594 family protein -
  IX83_RS06785 (IX83_07020) - 1589454..1589789 (-) 336 WP_038500643.1 hypothetical protein -
  IX83_RS06790 (IX83_07025) - 1589789..1590220 (-) 432 WP_143244833.1 hypothetical protein -
  IX83_RS06795 (IX83_07030) - 1590232..1590693 (-) 462 WP_038500649.1 hypothetical protein -
  IX83_RS06800 (IX83_07035) - 1590690..1591247 (-) 558 WP_038500652.1 hypothetical protein -
  IX83_RS06805 (IX83_07040) - 1591251..1593749 (-) 2499 WP_038500655.1 tail fiber protein -
  IX83_RS08645 - 1593826..1601415 (-) 7590 WP_051919476.1 hypothetical protein -
  IX83_RS06815 (IX83_07050) - 1601430..1603580 (-) 2151 WP_038500658.1 transglycosylase SLT domain-containing protein -
  IX83_RS06820 - 1603584..1604225 (-) 642 WP_174407400.1 hypothetical protein -
  IX83_RS09095 - 1604305..1606806 (-) 2502 WP_051919478.1 hypothetical protein -
  IX83_RS06835 (IX83_07070) - 1606819..1607427 (-) 609 WP_038500661.1 hypothetical protein -
  IX83_RS06840 (IX83_07075) - 1607484..1607669 (-) 186 WP_038500664.1 hypothetical protein -
  IX83_RS06845 (IX83_07080) - 1607682..1608062 (-) 381 WP_038500667.1 Bbp16 family capsid cement protein -
  IX83_RS06850 (IX83_07085) - 1608073..1609074 (-) 1002 WP_038500669.1 major capsid protein -
  IX83_RS06855 - 1609090..1609692 (-) 603 WP_051919481.1 hypothetical protein -
  IX83_RS06860 - 1609664..1609966 (-) 303 WP_051919483.1 hypothetical protein -
  IX83_RS06865 (IX83_07100) - 1609982..1611649 (-) 1668 WP_038500672.1 portal protein -
  IX83_RS06870 (IX83_07105) - 1611653..1612006 (-) 354 WP_038500675.1 hypothetical protein -
  IX83_RS06875 (IX83_07110) - 1612009..1612461 (-) 453 WP_038500678.1 hypothetical protein -
  IX83_RS06880 (IX83_07115) - 1612461..1612907 (-) 447 WP_038500681.1 GNAT family N-acetyltransferase -
  IX83_RS06885 (IX83_07120) - 1612970..1614583 (-) 1614 WP_201770238.1 terminase -
  IX83_RS06890 (IX83_07125) - 1614570..1615076 (-) 507 WP_051919485.1 hypothetical protein -
  IX83_RS06895 (IX83_07135) - 1615413..1615808 (-) 396 WP_038500684.1 DUF559 domain-containing protein -
  IX83_RS06900 - 1615805..1616569 (-) 765 WP_051919488.1 ATP-binding protein -
  IX83_RS08655 - 1616569..1617597 (-) 1029 WP_051919491.1 helix-turn-helix domain-containing protein -
  IX83_RS06915 (IX83_07155) - 1617600..1617797 (-) 198 WP_038500688.1 helix-turn-helix domain-containing protein -
  IX83_RS06920 (IX83_07160) - 1617799..1618047 (-) 249 WP_051919494.1 hypothetical protein -
  IX83_RS08660 - 1618129..1618809 (+) 681 WP_051919496.1 XRE family transcriptional regulator -
  IX83_RS06930 (IX83_07170) - 1618830..1619372 (+) 543 WP_038500691.1 hypothetical protein -
  IX83_RS06935 (IX83_07175) - 1619381..1620148 (+) 768 WP_038500694.1 hypothetical protein -
  IX83_RS09035 - 1620362..1620514 (+) 153 WP_158074684.1 hypothetical protein -
  IX83_RS06940 (IX83_07185) - 1620525..1620896 (+) 372 WP_038500697.1 hypothetical protein -
  IX83_RS06945 (IX83_07190) - 1620889..1621785 (+) 897 WP_038500700.1 hypothetical protein -
  IX83_RS09135 bet 1621802..1622650 (+) 849 WP_051919498.1 phage recombination protein Bet -
  IX83_RS06955 (IX83_07200) - 1622662..1623273 (+) 612 WP_038500703.1 YqaJ viral recombinase family protein -
  IX83_RS06960 (IX83_07205) ssb 1623275..1623754 (+) 480 WP_038500706.1 single-stranded DNA-binding protein Machinery gene
  IX83_RS06965 (IX83_07210) - 1623798..1624187 (+) 390 WP_038500709.1 hypothetical protein -
  IX83_RS06970 (IX83_07215) - 1624174..1624464 (+) 291 WP_038500712.1 hypothetical protein -
  IX83_RS06975 (IX83_07220) - 1624477..1624935 (+) 459 WP_038500715.1 DUF3310 domain-containing protein -
  IX83_RS06980 (IX83_07225) - 1625054..1625716 (+) 663 WP_038500718.1 hypothetical protein -
  IX83_RS08670 - 1626022..1626828 (+) 807 WP_051919501.1 KilA-N domain-containing protein -
  IX83_RS06990 (IX83_07235) - 1626868..1627869 (-) 1002 WP_038500721.1 site-specific integrase -
  IX83_RS07000 (IX83_07250) - 1628630..1630126 (+) 1497 WP_038500723.1 MBOAT family protein -
  IX83_RS09060 - 1630130..1631437 (+) 1308 WP_051919504.1 DUF459 domain-containing protein -
  IX83_RS07010 - 1631440..1632801 (+) 1362 WP_051919508.1 GDSL-type esterase/lipase family protein -
  IX83_RS08675 - 1632996..1633727 (-) 732 WP_051919509.1 SGNH hydrolase domain-containing protein -
  IX83_RS08680 - 1633717..1634913 (-) 1197 WP_051919512.1 acyltransferase -
  IX83_RS07020 (IX83_07270) - 1634920..1635537 (-) 618 WP_038500726.1 riboflavin synthase -
  IX83_RS07025 (IX83_07275) ribD 1635540..1636688 (-) 1149 WP_236620607.1 bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD -

Sequence

Protein


Download         Length: 159 a.a.        Molecular weight: 17814.52 Da        Isoelectric Point: 7.2011

>NTDB_id=127500 IX83_RS06960 WP_038500706.1 1623275..1623754(+) (ssb) [Basilea psittacipulmonis DSM 24701]
MSSVNKVILVGNLGRDPEHRVFPNSDGGVTNFSIATSYRTRGQDGNWNEETEWHNIVTFNRTAEVANQYLKKGSKVYVEG
RIRTRKWQDKMGQDRYTTEVLAEKLVLLGGDKAPQSSNANTSGGWDNNPSNPTNNAYLNAKNGTRPVNNVSDMEDDYPF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=127500 IX83_RS06960 WP_038500706.1 1623275..1623754(+) (ssb) [Basilea psittacipulmonis DSM 24701]
ATGTCATCAGTCAATAAAGTAATTTTAGTAGGTAACTTGGGAAGAGACCCGGAACATCGTGTGTTCCCGAATAGTGATGG
AGGTGTCACAAATTTTTCTATCGCCACTTCCTATCGTACACGAGGACAGGACGGTAATTGGAATGAGGAAACAGAATGGC
ACAATATCGTGACATTTAATCGTACAGCAGAGGTTGCTAACCAATACCTAAAAAAAGGCAGTAAGGTTTATGTCGAGGGT
CGCATTCGTACAAGAAAGTGGCAAGACAAAATGGGGCAGGACCGATACACAACTGAAGTACTTGCTGAAAAGCTTGTCTT
GCTAGGAGGCGATAAAGCACCACAATCATCGAATGCTAACACAAGTGGCGGTTGGGACAATAACCCATCTAACCCAACAA
ACAATGCATATTTGAACGCAAAAAACGGTACTCGCCCAGTGAATAACGTGTCCGACATGGAAGATGATTATCCGTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A077DE37

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

46.486

100

0.541
  ssb Vibrio cholerae strain A1552

41.954

100

0.459
  ssb Neisseria meningitidis MC58

38.506

100

0.421
  ssb Neisseria gonorrhoeae MS11

38.506

100

0.421

Multiple sequence alignment