Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   EG66_RS00195 Genome accession   NZ_CP007605
Coordinates   37339..37452 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain BM012B     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32339..42452
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EG66_RS00170 (EG66_00195) - 32401..34626 (+) 2226 WP_023591490.1 AAA family ATPase -
  EG66_RS00175 (EG66_00200) panD 34616..34969 (+) 354 WP_023591491.1 aspartate 1-decarboxylase -
  EG66_RS00180 (EG66_00205) - 34972..35265 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  EG66_RS00185 (EG66_00210) - 35265..36260 (+) 996 WP_038419552.1 PDZ domain-containing protein -
  EG66_RS00190 (EG66_00215) comB6 36268..37323 (+) 1056 WP_038419554.1 P-type conjugative transfer protein TrbL Machinery gene
  EG66_RS00195 comB7 37339..37452 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  EG66_RS00200 (EG66_00225) comB8 37449..38186 (+) 738 WP_038419556.1 type IV secretion system protein Machinery gene
  EG66_RS00205 (EG66_00230) comB9 38186..39172 (+) 987 WP_038419558.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EG66_RS00210 (EG66_00235) comB10 39165..40301 (+) 1137 WP_038419560.1 DNA type IV secretion system protein ComB10 Machinery gene
  EG66_RS00215 (EG66_00240) - 40372..41784 (+) 1413 WP_038419562.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=121585 EG66_RS00195 WP_001217873.1 37339..37452(+) (comB7) [Helicobacter pylori strain BM012B]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=121585 EG66_RS00195 WP_001217873.1 37339..37452(+) (comB7) [Helicobacter pylori strain BM012B]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment