Detailed information
Bioinformatically predicted
Overview
| Name | comM | Type | Machinery gene |
| Locus tag | AAGD27_RS08390 | Genome accession | NZ_OZ032158 |
| Coordinates | 1511814..1511906 (+) | Length | 30 a.a. |
| NCBI ID | WP_341754838.1 | Uniprot ID | - |
| Organism | Candidatus Tisiphia endosymbiont of Dioctria rufipes isolate 54724 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Genomic Context
Location: 1506814..1516906
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAGD27_RS08360 | asd | 1507085..1508110 (-) | 1026 | WP_341753695.1 | aspartate-semialdehyde dehydrogenase | - |
| AAGD27_RS08365 | - | 1508203..1508553 (-) | 351 | WP_341753696.1 | HIT domain-containing protein | - |
| AAGD27_RS08370 | - | 1508861..1509244 (-) | 384 | WP_341753697.1 | DUF2628 domain-containing protein | - |
| AAGD27_RS08375 | hslV | 1509335..1509901 (+) | 567 | WP_341753698.1 | ATP-dependent protease subunit HslV | - |
| AAGD27_RS08380 | hslU | 1509898..1511238 (+) | 1341 | WP_341753699.1 | ATP-dependent protease ATPase subunit HslU | - |
| AAGD27_RS08385 | - | 1511241..1511573 (+) | 333 | WP_341753700.1 | magnesium chelatase domain-containing protein | - |
| AAGD27_RS08390 | comM | 1511814..1511906 (+) | 93 | WP_341754838.1 | ATP-binding protein | Machinery gene |
| AAGD27_RS08395 | - | 1511867..1512046 (-) | 180 | Protein_1664 | IS5/IS1182 family transposase | - |
| AAGD27_RS08400 | - | 1512055..1513098 (-) | 1044 | WP_341753421.1 | IS630 family transposase | - |
| AAGD27_RS08405 | - | 1513151..1513315 (+) | 165 | WP_341753701.1 | hypothetical protein | - |
| AAGD27_RS08410 | atpA | 1513557..1515113 (-) | 1557 | WP_341753702.1 | F0F1 ATP synthase subunit alpha | - |
| AAGD27_RS08415 | atpH | 1515387..1515950 (-) | 564 | WP_341753703.1 | ATP synthase F1 subunit delta | - |
Sequence
Protein
Download Length: 30 a.a. Molecular weight: 3368.95 Da Isoelectric Point: 11.0566
>NTDB_id=1163417 AAGD27_RS08390 WP_341754838.1 1511814..1511906(+) (comM) [Candidatus Tisiphia endosymbiont of Dioctria rufipes isolate 54724]
MKGQKVAKRALEIAASGSHNLLDLFRNWLT
MKGQKVAKRALEIAASGSHNLLDLFRNWLT
Nucleotide
Download Length: 93 bp
>NTDB_id=1163417 AAGD27_RS08390 WP_341754838.1 1511814..1511906(+) (comM) [Candidatus Tisiphia endosymbiont of Dioctria rufipes isolate 54724]
ATCAAAGGACAAAAAGTAGCCAAGCGAGCTTTAGAAATAGCGGCCTCTGGTAGTCACAATCTATTAGACCTCTTTCGAAA
CTGGTTAACGTAG
ATCAAAGGACAAAAAGTAGCCAAGCGAGCTTTAGAAATAGCGGCCTCTGGTAGTCACAATCTATTAGACCTCTTTCGAAA
CTGGTTAACGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comM | Glaesserella parasuis strain SC1401 |
80 |
66.667 |
0.533 |
| comM | Vibrio cholerae strain A1552 |
72.727 |
73.333 |
0.533 |
| comM | Haemophilus influenzae Rd KW20 |
72.727 |
73.333 |
0.533 |
| comM | Vibrio campbellii strain DS40M4 |
75 |
66.667 |
0.5 |
| RA0C_RS07335 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
59.091 |
73.333 |
0.433 |
| comM | Legionella pneumophila str. Paris |
54.545 |
73.333 |
0.4 |
| comM | Legionella pneumophila strain ERS1305867 |
54.545 |
73.333 |
0.4 |