Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACI6O7_RS11355 Genome accession   NZ_OY725152
Coordinates   2272097..2272381 (-) Length   94 a.a.
NCBI ID   WP_404378643.1    Uniprot ID   -
Organism   Lactococcus lactis strain IMDO WA12L8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2267097..2277381
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACI6O7_RS11325 (LLWA12L8_FAMOGCFE_02270) - 2267536..2267913 (-) 378 WP_033900715.1 pyridoxamine 5'-phosphate oxidase family protein -
  ACI6O7_RS11330 (LLWA12L8_FAMOGCFE_02271) - 2268118..2268984 (+) 867 WP_237579725.1 RluA family pseudouridine synthase -
  ACI6O7_RS11335 (LLWA12L8_FAMOGCFE_02272) - 2269023..2269832 (-) 810 WP_014570791.1 metal ABC transporter permease -
  ACI6O7_RS11340 (LLWA12L8_FAMOGCFE_02273) - 2269825..2270562 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  ACI6O7_RS11345 (LLWA12L8_FAMOGCFE_02274) - 2270739..2271581 (-) 843 WP_278218023.1 metal ABC transporter substrate-binding protein -
  ACI6O7_RS11350 (LLWA12L8_FAMOGCFE_02275) - 2271578..2272015 (-) 438 WP_201248645.1 zinc-dependent MarR family transcriptional regulator -
  ACI6O7_RS11355 (LLWA12L8_FAMOGCFE_02276) comGG 2272097..2272381 (-) 285 WP_404378643.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACI6O7_RS11360 (LLWA12L8_FAMOGCFE_02277) comGF 2272420..2272866 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACI6O7_RS11365 (LLWA12L8_FAMOGCFE_02278) comGE 2272829..2273125 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACI6O7_RS11370 (LLWA12L8_FAMOGCFE_02279) comGD 2273097..2273528 (-) 432 WP_341275869.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACI6O7_RS11375 (LLWA12L8_FAMOGCFE_02280) comGC 2273488..2273757 (-) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  ACI6O7_RS11380 (LLWA12L8_FAMOGCFE_02281) comGB 2273885..2274958 (-) 1074 WP_010906319.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACI6O7_RS11385 (LLWA12L8_FAMOGCFE_02282) comGA 2274852..2275790 (-) 939 WP_143459428.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5802

>NTDB_id=1160554 ACI6O7_RS11355 WP_404378643.1 2272097..2272381(-) (comGG) [Lactococcus lactis strain IMDO WA12L8]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTNLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=1160554 ACI6O7_RS11355 WP_404378643.1 2272097..2272381(-) (comGG) [Lactococcus lactis strain IMDO WA12L8]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTAATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

57.447

100

0.574

Multiple sequence alignment