Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | AD178_RS11060 | Genome accession | NZ_OX244288 |
| Coordinates | 2143974..2144099 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain PT8105 isolate 2RLC4 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2138974..2149099
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AD178_RS11030 | - | 2139313..2140987 (-) | 1675 | Protein_2144 | YhgE/Pip domain-containing protein | - |
| AD178_RS11035 (SAMEA1463109_02228) | - | 2141094..2141636 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| AD178_RS11050 (SAMEA1463109_02231) | comE | 2141879..2142631 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| AD178_RS11055 (SAMEA1463109_02232) | comD/comD2 | 2142628..2143953 (-) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| AD178_RS11060 (SAMEA1463109_02233) | comC/comC2 | 2143974..2144099 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| AD178_RS11070 (SAMEA1463109_02235) | rlmH | 2144381..2144860 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| AD178_RS11075 (SAMEA1463109_02236) | htrA | 2145043..2146224 (+) | 1182 | WP_000681590.1 | trypsin-like peptidase domain-containing protein | Regulator |
| AD178_RS11080 (SAMEA1463109_02237) | spo0J | 2146282..2147040 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=1154372 AD178_RS11060 WP_000799686.1 2143974..2144099(-) (comC/comC2) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=1154372 AD178_RS11060 WP_000799686.1 2143974..2144099(-) (comC/comC2) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |