Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   DXE59_RS03275 Genome accession   NZ_LT992467
Coordinates   617097..617567 (-) Length   156 a.a.
NCBI ID   WP_000610650.1    Uniprot ID   -
Organism   Staphylococcus aureus isolate 16_LA_309     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 587646..640141 617097..617567 within 0


Gene organization within MGE regions


Location: 587646..640141
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXE59_RS03045 scn 587646..587996 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  DXE59_RS03050 - 588679..589128 (+) 450 WP_000727643.1 chemotaxis-inhibiting protein CHIPS -
  DXE59_RS03055 - 589221..589558 (-) 338 Protein_551 SH3 domain-containing protein -
  DXE59_RS03075 sak 590206..590697 (-) 492 WP_000920041.1 staphylokinase -
  DXE59_RS03080 - 590889..591644 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  DXE59_RS03085 - 591656..591910 (-) 255 WP_000611512.1 phage holin -
  DXE59_RS03090 - 591962..592069 (+) 108 WP_031762631.1 hypothetical protein -
  DXE59_RS03095 pepG1 592122..592256 (-) 135 WP_000880504.1 type I toxin-antitoxin system toxin PepG1 -
  DXE59_RS03100 - 592450..592746 (-) 297 WP_000539688.1 DUF2951 domain-containing protein -
  DXE59_RS03105 - 592804..593091 (-) 288 WP_001040261.1 hypothetical protein -
  DXE59_RS03110 - 593138..593290 (-) 153 WP_001153681.1 hypothetical protein -
  DXE59_RS03115 - 593280..597065 (-) 3786 WP_114636066.1 phage tail spike protein -
  DXE59_RS03120 - 597081..598565 (-) 1485 WP_000567408.1 phage distal tail protein -
  DXE59_RS03125 - 598562..603091 (-) 4530 WP_114636067.1 phage tail tape measure protein -
  DXE59_RS15135 gpGT 603148..603285 (-) 138 WP_001549167.1 phage tail assembly chaperone GT -
  DXE59_RS03130 gpG 603336..603686 (-) 351 WP_001096353.1 phage tail assembly chaperone G -
  DXE59_RS03135 - 603736..604041 (-) 306 WP_114636068.1 Ig-like domain-containing protein -
  DXE59_RS03140 - 604002..604643 (-) 642 WP_114636069.1 major tail protein -
  DXE59_RS03145 - 604644..605051 (-) 408 WP_086095461.1 hypothetical protein -
  DXE59_RS03150 - 605048..605452 (-) 405 WP_000114341.1 HK97 gp10 family phage protein -
  DXE59_RS03155 - 605449..605811 (-) 363 WP_000755150.1 head-tail adaptor protein -
  DXE59_RS03160 - 605795..606079 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  DXE59_RS03165 - 606069..606353 (-) 285 WP_000238240.1 hypothetical protein -
  DXE59_RS03170 - 606373..607518 (-) 1146 WP_033857025.1 phage major capsid protein -
  DXE59_RS03175 - 607541..608278 (-) 738 WP_033857027.1 head maturation protease, ClpP-related -
  DXE59_RS03180 - 608262..609434 (-) 1173 WP_114636070.1 phage portal protein -
  DXE59_RS03185 - 609450..611111 (-) 1662 WP_000625085.1 terminase large subunit -
  DXE59_RS03190 - 611108..611452 (-) 345 WP_000402904.1 hypothetical protein -
  DXE59_RS03195 - 611582..611881 (-) 300 WP_000988333.1 HNH endonuclease -
  DXE59_RS03200 - 612113..612529 (-) 417 WP_000590122.1 hypothetical protein -
  DXE59_RS03205 - 612557..612757 (-) 201 WP_001794311.1 DUF1514 family protein -
  DXE59_RS03210 rinB 612757..612906 (-) 150 WP_114636071.1 transcriptional activator RinB -
  DXE59_RS03215 - 612903..613292 (-) 390 WP_001596346.1 hypothetical protein -
  DXE59_RS03220 - 613282..613518 (-) 237 WP_000608275.1 DUF7366 family protein -
  DXE59_RS03225 - 613511..613714 (-) 204 WP_000141180.1 hypothetical protein -
  DXE59_RS03230 - 613711..613917 (-) 207 WP_000195794.1 DUF1381 domain-containing protein -
  DXE59_RS03235 - 613954..614490 (-) 537 WP_031881549.1 dUTPase -
  DXE59_RS03240 - 614483..614653 (-) 171 WP_000714407.1 hypothetical protein -
  DXE59_RS03245 - 614640..614894 (-) 255 WP_114636072.1 DUF1024 family protein -
  DXE59_RS03250 - 614909..615151 (-) 243 WP_000131370.1 SAV1978 family virulence-associated passenger protein -
  DXE59_RS03255 - 615155..615523 (-) 369 WP_114636073.1 SA1788 family PVL leukocidin-associated protein -
  DXE59_RS03260 - 615536..615940 (-) 405 WP_000401960.1 RusA family crossover junction endodeoxyribonuclease -
  DXE59_RS03265 - 615949..616167 (-) 219 WP_000338530.1 hypothetical protein -
  DXE59_RS03270 - 616174..617067 (-) 894 WP_000148335.1 DnaD domain protein -
  DXE59_RS03275 ssbA 617097..617567 (-) 471 WP_000610650.1 single-stranded DNA-binding protein Machinery gene
  DXE59_RS03280 - 617568..618185 (-) 618 WP_114636074.1 MBL fold metallo-hydrolase -
  DXE59_RS03285 - 618266..619186 (-) 921 WP_031763788.1 recombinase RecT -
  DXE59_RS03290 - 619188..621143 (-) 1956 WP_174220649.1 AAA family ATPase -
  DXE59_RS03295 - 621140..621403 (-) 264 WP_001205732.1 hypothetical protein -
  DXE59_RS03300 - 621412..621672 (-) 261 WP_031763794.1 DUF1108 family protein -
  DXE59_RS03305 - 621677..621979 (-) 303 WP_000165371.1 DUF2482 family protein -
  DXE59_RS03310 - 622074..622235 (-) 162 WP_000048129.1 DUF1270 family protein -
  DXE59_RS03315 - 622232..622555 (-) 324 WP_001120201.1 DUF771 domain-containing protein -
  DXE59_RS03320 - 622610..622990 (+) 381 WP_000762521.1 DUF2513 domain-containing protein -
  DXE59_RS03325 - 622977..623174 (-) 198 WP_001148856.1 hypothetical protein -
  DXE59_RS03330 - 623190..623939 (-) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  DXE59_RS03335 - 623996..624535 (+) 540 WP_000351243.1 hypothetical protein -
  DXE59_RS03340 - 624559..624819 (-) 261 WP_000435341.1 transcriptional regulator -
  DXE59_RS03345 - 624867..625079 (-) 213 WP_000213811.1 helix-turn-helix transcriptional regulator -
  DXE59_RS03350 - 625231..625962 (+) 732 WP_031924696.1 XRE family transcriptional regulator -
  DXE59_RS03355 - 625978..626910 (+) 933 WP_000759682.1 exonuclease domain-containing protein -
  DXE59_RS03360 - 626916..627257 (+) 342 WP_000591749.1 hypothetical protein -
  DXE59_RS03365 - 627460..627627 (+) 168 WP_000705241.1 hypothetical protein -
  DXE59_RS03370 - 627767..628471 (+) 705 WP_000440838.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DXE59_RS03375 - 628665..629702 (+) 1038 WP_000857198.1 tyrosine-type recombinase/integrase -
  DXE59_RS03380 sph 629759..630583 (+) 825 Protein_614 sphingomyelin phosphodiesterase -
  DXE59_RS03385 - 630845..631861 (-) 1017 WP_000595612.1 leukocidin/hemolysin toxin family protein -
  DXE59_RS03390 - 631883..632938 (-) 1056 WP_000791397.1 leukocidin family pore-forming toxin -
  DXE59_RS03395 - 633370..634593 (+) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  DXE59_RS03400 - 634976..636283 (+) 1308 WP_001045074.1 TrkH family potassium uptake protein -
  DXE59_RS14905 - 636822..637448 (-) 627 WP_000216896.1 hypothetical protein -
  DXE59_RS03420 - 637445..637624 (-) 180 WP_000201398.1 hypothetical protein -
  DXE59_RS03425 groL 638165..639781 (-) 1617 WP_000240642.1 chaperonin GroEL -
  DXE59_RS03430 groES 639857..640141 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17658.50 Da        Isoelectric Point: 4.9628

>NTDB_id=1149685 DXE59_RS03275 WP_000610650.1 617097..617567(-) (ssbA) [Staphylococcus aureus isolate 16_LA_309]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1149685 DXE59_RS03275 WP_000610650.1 617097..617567(-) (ssbA) [Staphylococcus aureus isolate 16_LA_309]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment