Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CS885_RS05555 Genome accession   NZ_LT838273
Coordinates   1127081..1127194 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori isolate HE93/10_v1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1122081..1132194
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS885_RS05530 - 1122122..1124350 (+) 2229 WP_089086473.1 AAA family ATPase -
  CS885_RS05535 panD 1124340..1124693 (+) 354 WP_000142286.1 aspartate 1-decarboxylase -
  CS885_RS05540 - 1124696..1124998 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  CS885_RS05545 - 1124998..1126002 (+) 1005 WP_089086474.1 PDZ domain-containing protein -
  CS885_RS05550 comB6 1126010..1127065 (+) 1056 WP_089086475.1 P-type conjugative transfer protein TrbL Machinery gene
  CS885_RS05555 comB7 1127081..1127194 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  CS885_RS05560 comB8 1127191..1127934 (+) 744 WP_000660557.1 type IV secretion system protein Machinery gene
  CS885_RS05565 comB9 1127934..1128920 (+) 987 WP_089086476.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CS885_RS05570 comB10 1128913..1130049 (+) 1137 WP_089086477.1 DNA type IV secretion system protein ComB10 Machinery gene
  CS885_RS05575 - 1130119..1131531 (+) 1413 WP_089086478.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=1146403 CS885_RS05555 WP_001217877.1 1127081..1127194(+) (comB7) [Helicobacter pylori isolate HE93/10_v1]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1146403 CS885_RS05555 WP_001217877.1 1127081..1127194(+) (comB7) [Helicobacter pylori isolate HE93/10_v1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment