Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPOKI673_RS07505 Genome accession   NZ_CP006825
Coordinates   1558413..1558526 (-) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   A0AAE7DTV1
Organism   Helicobacter pylori oki673     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1553413..1563526
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOKI673_RS07485 (HPOKI673_07810) - 1554100..1555512 (-) 1413 WP_025314236.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPOKI673_RS07490 (HPOKI673_07815) comB10 1555582..1556718 (-) 1137 WP_025314237.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOKI673_RS07495 (HPOKI673_07820) comB9 1556711..1557673 (-) 963 WP_025314238.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOKI673_RS07500 (HPOKI673_07825) comB8 1557673..1558416 (-) 744 WP_025314239.1 type IV secretion system protein Machinery gene
  HPOKI673_RS07505 (HPOKI673_07830) comB7 1558413..1558526 (-) 114 WP_001217868.1 hypothetical protein Machinery gene
  HPOKI673_RS07510 (HPOKI673_07835) comB6 1558542..1559597 (-) 1056 WP_025314240.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOKI673_RS07515 (HPOKI673_07840) - 1559605..1560600 (-) 996 WP_025314241.1 PDZ domain-containing protein -
  HPOKI673_RS07520 (HPOKI673_07845) - 1560600..1560893 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  HPOKI673_RS07525 (HPOKI673_07850) panD 1560904..1561254 (-) 351 WP_025314242.1 aspartate 1-decarboxylase -
  HPOKI673_RS07530 (HPOKI673_07855) - 1561244..1563469 (-) 2226 WP_025314243.1 AAA family ATPase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=114238 HPOKI673_RS07505 WP_001217868.1 1558413..1558526(-) (comB7) [Helicobacter pylori oki673]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=114238 HPOKI673_RS07505 WP_001217868.1 1558413..1558526(-) (comB7) [Helicobacter pylori oki673]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919

Multiple sequence alignment