Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DQL80_RS10245 | Genome accession | NZ_LS483302 |
| Coordinates | 2010418..2010888 (-) | Length | 156 a.a. |
| NCBI ID | WP_111680167.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain NCTC8726 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1981468..2031966 | 2010418..2010888 | within | 0 |
Gene organization within MGE regions
Location: 1981468..2031966
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL80_RS10030 (NCTC8726_01891) | scn | 1981468..1981818 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| DQL80_RS10035 (NCTC8726_01893) | - | 1982330..1982671 (-) | 342 | Protein_1866 | SH3 domain-containing protein | - |
| DQL80_RS10050 (NCTC8726_01894) | sak | 1983272..1983763 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| DQL80_RS10055 (NCTC8726_01895) | - | 1983954..1984709 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DQL80_RS10060 (NCTC8726_01896) | - | 1984721..1984975 (-) | 255 | WP_000611512.1 | phage holin | - |
| DQL80_RS10065 | - | 1985027..1985134 (+) | 108 | WP_031790389.1 | hypothetical protein | - |
| DQL80_RS10070 | pepG1 | 1985187..1985321 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| DQL80_RS10075 (NCTC8726_01898) | - | 1985513..1985809 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DQL80_RS10080 (NCTC8726_01899) | - | 1985867..1986154 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| DQL80_RS10085 (NCTC8726_01900) | - | 1986201..1986353 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| DQL80_RS10090 (NCTC8726_01901) | - | 1986343..1990128 (-) | 3786 | WP_111680465.1 | phage tail spike protein | - |
| DQL80_RS10095 (NCTC8726_01902) | - | 1990144..1991628 (-) | 1485 | WP_031766050.1 | phage distal tail protein | - |
| DQL80_RS10100 (NCTC8726_01903) | - | 1991625..1996154 (-) | 4530 | WP_111680466.1 | phage tail tape measure protein | - |
| DQL80_RS14210 (NCTC8726_01904) | gpGT | 1996211..1996348 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| DQL80_RS10105 (NCTC8726_01905) | gpG | 1996399..1996749 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| DQL80_RS10110 | - | 1996799..1997023 (-) | 225 | WP_078103060.1 | Ig-like domain-containing protein | - |
| DQL80_RS10115 (NCTC8726_01906) | - | 1997065..1997709 (-) | 645 | WP_000268741.1 | major tail protein | - |
| DQL80_RS10120 (NCTC8726_01907) | - | 1997710..1998117 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| DQL80_RS10125 (NCTC8726_01908) | - | 1998114..1998518 (-) | 405 | WP_000114341.1 | HK97 gp10 family phage protein | - |
| DQL80_RS10130 (NCTC8726_01909) | - | 1998515..1998877 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| DQL80_RS10135 (NCTC8726_01910) | - | 1998861..1999145 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| DQL80_RS10140 (NCTC8726_01911) | - | 1999135..1999419 (-) | 285 | WP_000238240.1 | hypothetical protein | - |
| DQL80_RS10145 (NCTC8726_01912) | - | 1999439..2000584 (-) | 1146 | WP_111680467.1 | phage major capsid protein | - |
| DQL80_RS10150 (NCTC8726_01913) | - | 2000607..2001344 (-) | 738 | WP_099119666.1 | head maturation protease, ClpP-related | - |
| DQL80_RS10155 (NCTC8726_01914) | - | 2001328..2002515 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| DQL80_RS10160 (NCTC8726_01915) | - | 2002531..2004192 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| DQL80_RS10165 (NCTC8726_01916) | - | 2004189..2004533 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| DQL80_RS10170 (NCTC8726_01917) | - | 2004664..2004963 (-) | 300 | WP_000988330.1 | HNH endonuclease | - |
| DQL80_RS10175 (NCTC8726_01918) | - | 2005195..2005611 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| DQL80_RS10180 (NCTC8726_01919) | - | 2005639..2005839 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| DQL80_RS10185 (NCTC8726_01920) | - | 2005839..2006489 (-) | 651 | WP_111680468.1 | hypothetical protein | - |
| DQL80_RS10190 (NCTC8726_01922) | rinB | 2006648..2006797 (-) | 150 | WP_000237868.1 | transcriptional activator RinB | - |
| DQL80_RS10195 (NCTC8726_01923) | - | 2006800..2007000 (-) | 201 | WP_001125015.1 | hypothetical protein | - |
| DQL80_RS10200 (NCTC8726_01924) | - | 2006975..2007163 (-) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| DQL80_RS10205 (NCTC8726_01925) | - | 2007160..2007405 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| DQL80_RS10210 (NCTC8726_01926) | - | 2007442..2007951 (-) | 510 | WP_111680170.1 | dUTP diphosphatase | - |
| DQL80_RS10215 (NCTC8726_01927) | - | 2007944..2008192 (-) | 249 | WP_031889594.1 | DUF1024 family protein | - |
| DQL80_RS10220 (NCTC8726_01928) | - | 2008233..2008481 (-) | 249 | WP_111680169.1 | phi PVL orf 51-like protein | - |
| DQL80_RS10225 (NCTC8726_01929) | - | 2008482..2008853 (-) | 372 | WP_031795767.1 | SA1788 family PVL leukocidin-associated protein | - |
| DQL80_RS10230 (NCTC8726_01930) | - | 2008866..2009270 (-) | 405 | WP_000401971.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQL80_RS10235 (NCTC8726_01931) | - | 2009279..2009497 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| DQL80_RS10240 (NCTC8726_01932) | - | 2009504..2010388 (-) | 885 | WP_111680168.1 | DnaD domain protein | - |
| DQL80_RS10245 (NCTC8726_01933) | ssbA | 2010418..2010888 (-) | 471 | WP_111680167.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL80_RS10250 (NCTC8726_01934) | - | 2010889..2011506 (-) | 618 | WP_078092708.1 | MBL fold metallo-hydrolase | - |
| DQL80_RS10255 (NCTC8726_01935) | - | 2011587..2012507 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| DQL80_RS10260 (NCTC8726_01936) | - | 2012509..2014464 (-) | 1956 | WP_172452437.1 | AAA family ATPase | - |
| DQL80_RS10265 (NCTC8726_01937) | - | 2014461..2014724 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| DQL80_RS10270 (NCTC8726_01938) | - | 2014733..2014993 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| DQL80_RS10275 (NCTC8726_01939) | - | 2015086..2015247 (-) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| DQL80_RS10280 (NCTC8726_01940) | - | 2015244..2015564 (-) | 321 | WP_001120936.1 | DUF771 domain-containing protein | - |
| DQL80_RS14215 | - | 2015713..2015812 (-) | 100 | Protein_1915 | hypothetical protein | - |
| DQL80_RS14220 (NCTC8726_01942) | - | 2015809..2016087 (-) | 279 | WP_001206962.1 | hypothetical protein | - |
| DQL80_RS14225 | - | 2016191..2016346 (+) | 156 | Protein_1917 | hypothetical protein | - |
| DQL80_RS10295 (NCTC8726_01943) | - | 2016370..2016630 (-) | 261 | WP_000435343.1 | hypothetical protein | - |
| DQL80_RS10300 (NCTC8726_01944) | - | 2016643..2017392 (-) | 750 | WP_111680469.1 | phage antirepressor KilAC domain-containing protein | - |
| DQL80_RS10305 (NCTC8726_01945) | - | 2017449..2017658 (+) | 210 | WP_000772137.1 | hypothetical protein | - |
| DQL80_RS10310 (NCTC8726_01946) | - | 2017651..2017791 (-) | 141 | WP_000939495.1 | hypothetical protein | - |
| DQL80_RS10315 (NCTC8726_01947) | - | 2017806..2018249 (-) | 444 | WP_111680470.1 | hypothetical protein | - |
| DQL80_RS10320 (NCTC8726_01948) | - | 2018262..2018504 (-) | 243 | WP_000639923.1 | DUF739 family protein | - |
| DQL80_RS10325 (NCTC8726_01949) | - | 2018668..2019384 (+) | 717 | WP_001083975.1 | LexA family transcriptional regulator | - |
| DQL80_RS10330 (NCTC8726_01950) | - | 2019396..2020250 (+) | 855 | WP_001557601.1 | HIRAN domain-containing protein | - |
| DQL80_RS14120 (NCTC8726_01951) | - | 2020324..2020470 (+) | 147 | WP_000345949.1 | hypothetical protein | - |
| DQL80_RS10335 (NCTC8726_01952) | - | 2020467..2020652 (+) | 186 | WP_000109189.1 | hypothetical protein | - |
| DQL80_RS10340 (NCTC8726_01953) | - | 2020723..2020905 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| DQL80_RS10345 (NCTC8726_01954) | - | 2020983..2021696 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQL80_RS10350 (NCTC8726_01955) | - | 2021888..2022925 (+) | 1038 | WP_000857198.1 | tyrosine-type recombinase/integrase | - |
| DQL80_RS10355 (NCTC8726_01956) | sph | 2022970..2023806 (+) | 837 | Protein_1931 | sphingomyelin phosphodiesterase | - |
| DQL80_RS10360 (NCTC8726_01957) | - | 2024063..2025082 (-) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| DQL80_RS10365 (NCTC8726_01958) | - | 2025104..2026159 (-) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| DQL80_RS10370 (NCTC8726_01959) | - | 2026590..2027813 (+) | 1224 | WP_111680471.1 | ArgE/DapE family deacylase | - |
| DQL80_RS10375 (NCTC8726_01960) | - | 2028151..2029458 (+) | 1308 | WP_111680472.1 | TrkH family potassium uptake protein | - |
| DQL80_RS10380 (NCTC8726_01961) | groL | 2029990..2031606 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| DQL80_RS10385 (NCTC8726_01962) | groES | 2031682..2031966 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17603.51 Da Isoelectric Point: 5.2672
>NTDB_id=1135615 DQL80_RS10245 WP_111680167.1 2010418..2010888(-) (ssbA) [Staphylococcus aureus strain NCTC8726]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1135615 DQL80_RS10245 WP_111680167.1 2010418..2010888(-) (ssbA) [Staphylococcus aureus strain NCTC8726]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.192 |
100 |
0.66 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
67.949 |
0.41 |
| ssb | Glaesserella parasuis strain SC1401 |
33.333 |
100 |
0.378 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |