Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   DQL80_RS04275 Genome accession   NZ_LS483302
Coordinates   854242..854712 (+) Length   156 a.a.
NCBI ID   WP_111680167.1    Uniprot ID   -
Organism   Staphylococcus aureus strain NCTC8726     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 842827..885480 854242..854712 within 0


Gene organization within MGE regions


Location: 842827..885480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQL80_RS04195 (NCTC8726_00792) sufB 842827..844224 (+) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
  DQL80_RS04200 (NCTC8726_00793) - 844292..845341 (-) 1050 WP_111680166.1 tyrosine-type recombinase/integrase -
  DQL80_RS04205 (NCTC8726_00794) - 845403..846644 (-) 1242 WP_031923531.1 SAP domain-containing protein -
  DQL80_RS04210 (NCTC8726_00795) - 846689..847363 (-) 675 WP_031916497.1 ImmA/IrrE family metallo-endopeptidase -
  DQL80_RS04215 (NCTC8726_00796) - 847380..847712 (-) 333 WP_001055142.1 helix-turn-helix domain-containing protein -
  DQL80_RS04220 (NCTC8726_00797) - 847974..848168 (+) 195 WP_031916498.1 helix-turn-helix domain-containing protein -
  DQL80_RS04225 (NCTC8726_00798) - 848177..848941 (+) 765 WP_111680717.1 phage antirepressor -
  DQL80_RS04230 (NCTC8726_00799) tscA 848942..849166 (+) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  DQL80_RS04235 (NCTC8726_00800) - 849206..849655 (+) 450 WP_000993183.1 hypothetical protein -
  DQL80_RS04240 (NCTC8726_00801) - 849669..849890 (+) 222 WP_031923535.1 hypothetical protein -
  DQL80_RS04245 (NCTC8726_00802) - 849883..850044 (+) 162 WP_000048129.1 DUF1270 family protein -
  DQL80_RS04250 (NCTC8726_00803) - 850137..850397 (+) 261 WP_000291488.1 DUF1108 family protein -
  DQL80_RS04255 (NCTC8726_00804) - 850406..850669 (+) 264 WP_001205732.1 hypothetical protein -
  DQL80_RS04260 (NCTC8726_00805) - 850666..852621 (+) 1956 WP_172452437.1 AAA family ATPase -
  DQL80_RS04265 (NCTC8726_00806) - 852623..853543 (+) 921 WP_000138475.1 recombinase RecT -
  DQL80_RS04270 (NCTC8726_00807) - 853624..854241 (+) 618 WP_078092708.1 MBL fold metallo-hydrolase -
  DQL80_RS04275 (NCTC8726_00808) ssbA 854242..854712 (+) 471 WP_111680167.1 single-stranded DNA-binding protein Machinery gene
  DQL80_RS04280 (NCTC8726_00809) - 854742..855626 (+) 885 WP_111680168.1 DnaD domain protein -
  DQL80_RS04285 (NCTC8726_00810) - 855633..855851 (+) 219 WP_000338530.1 hypothetical protein -
  DQL80_RS04290 (NCTC8726_00811) - 855860..856264 (+) 405 WP_000401971.1 RusA family crossover junction endodeoxyribonuclease -
  DQL80_RS04295 (NCTC8726_00812) - 856277..856648 (+) 372 WP_031795767.1 SA1788 family PVL leukocidin-associated protein -
  DQL80_RS04300 (NCTC8726_00813) - 856649..856897 (+) 249 WP_111680169.1 phi PVL orf 51-like protein -
  DQL80_RS04305 (NCTC8726_00814) - 856938..857186 (+) 249 WP_031889594.1 DUF1024 family protein -
  DQL80_RS04310 (NCTC8726_00815) - 857179..857688 (+) 510 WP_111680170.1 dUTP diphosphatase -
  DQL80_RS04315 (NCTC8726_00816) - 857725..857970 (+) 246 WP_001282074.1 hypothetical protein -
  DQL80_RS04320 (NCTC8726_00817) - 857967..858155 (+) 189 WP_000195782.1 DUF1381 domain-containing protein -
  DQL80_RS04325 (NCTC8726_00818) - 858130..858330 (+) 201 WP_001125015.1 hypothetical protein -
  DQL80_RS04330 (NCTC8726_00819) rinB 858333..858506 (+) 174 WP_172452438.1 transcriptional activator RinB -
  DQL80_RS04335 (NCTC8726_00820) - 858507..858872 (+) 366 WP_072467781.1 hypothetical protein -
  DQL80_RS04340 (NCTC8726_00821) - 858873..859019 (+) 147 WP_000990005.1 hypothetical protein -
  DQL80_RS04345 (NCTC8726_00822) - 859043..859465 (+) 423 WP_000162701.1 RinA family phage transcriptional activator -
  DQL80_RS04350 (NCTC8726_00823) - 859796..860290 (+) 495 WP_000594088.1 terminase small subunit -
  DQL80_RS04355 (NCTC8726_00824) - 860283..861506 (+) 1224 WP_001037578.1 PBSX family phage terminase large subunit -
  DQL80_RS04360 (NCTC8726_00825) - 861503..862927 (+) 1425 WP_031784361.1 phage portal protein -
  DQL80_RS04365 (NCTC8726_00826) - 862896..863849 (+) 954 WP_111680172.1 phage head morphogenesis protein -
  DQL80_RS04370 (NCTC8726_00827) - 863851..864057 (+) 207 WP_000346032.1 hypothetical protein -
  DQL80_RS04375 (NCTC8726_00828) - 864160..864744 (+) 585 WP_111680173.1 DUF4355 domain-containing protein -
  DQL80_RS04380 (NCTC8726_00829) - 864761..865675 (+) 915 WP_000235168.1 phage major capsid protein -
  DQL80_RS14105 (NCTC8726_00830) - 865687..865830 (+) 144 WP_000002931.1 hypothetical protein -
  DQL80_RS04385 (NCTC8726_00831) - 865836..866186 (+) 351 WP_000177351.1 phage head-tail adapter protein -
  DQL80_RS04390 (NCTC8726_00832) - 866198..866533 (+) 336 WP_000483041.1 phage head closure protein -
  DQL80_RS04395 (NCTC8726_00833) - 866520..866927 (+) 408 WP_111680174.1 HK97-gp10 family putative phage morphogenesis protein -
  DQL80_RS04400 (NCTC8726_00834) - 866940..867365 (+) 426 WP_000270190.1 DUF3168 domain-containing protein -
  DQL80_RS04405 (NCTC8726_00835) - 867366..867923 (+) 558 WP_000057582.1 tail protein -
  DQL80_RS04410 (NCTC8726_00836) - 867990..868496 (+) 507 WP_000134337.1 tail assembly chaperone -
  DQL80_RS04415 (NCTC8726_00837) - 868541..868825 (+) 285 WP_000880587.1 hypothetical protein -
  DQL80_RS04420 (NCTC8726_00838) - 868829..871714 (+) 2886 WP_111680175.1 terminase -
  DQL80_RS04425 (NCTC8726_00839) - 871729..872670 (+) 942 WP_111680176.1 phage tail domain-containing protein -
  DQL80_RS04430 (NCTC8726_00840) - 872681..874567 (+) 1887 WP_001604154.1 SGNH/GDSL hydrolase family protein -
  DQL80_RS04435 (NCTC8726_00841) - 874580..876478 (+) 1899 WP_111680177.1 hypothetical protein -
  DQL80_RS04440 (NCTC8726_00842) - 876478..878301 (+) 1824 WP_111680178.1 phage baseplate upper protein -
  DQL80_RS04445 (NCTC8726_00843) - 878301..878678 (+) 378 WP_000705919.1 DUF2977 domain-containing protein -
  DQL80_RS04450 (NCTC8726_00844) - 878688..878861 (+) 174 WP_015990323.1 XkdX family protein -
  DQL80_RS04455 (NCTC8726_00845) - 878902..879201 (+) 300 WP_000466784.1 DUF2951 domain-containing protein -
  DQL80_RS04460 (NCTC8726_00846) - 879338..881212 (+) 1875 WP_111680179.1 glucosaminidase domain-containing protein -
  DQL80_RS04465 (NCTC8726_00847) - 881225..882397 (+) 1173 WP_111680180.1 BppU family phage baseplate upper protein -
  DQL80_RS04470 (NCTC8726_00848) - 882403..882798 (+) 396 WP_015978410.1 hypothetical protein -
  DQL80_RS04475 (NCTC8726_00849) - 882854..883291 (+) 438 WP_111680181.1 phage holin -
  DQL80_RS04480 (NCTC8726_00850) - 883272..884717 (+) 1446 WP_001148115.1 SH3 domain-containing protein -
  DQL80_RS04485 (NCTC8726_00851) - 884960..885112 (+) 153 WP_001788502.1 hypothetical protein -
  DQL80_RS04490 (NCTC8726_00852) - 885183..885293 (+) 111 WP_000139425.1 hypothetical protein -
  DQL80_RS04495 (NCTC8726_00853) - 885295..885480 (+) 186 WP_001286805.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17603.51 Da        Isoelectric Point: 5.2672

>NTDB_id=1135588 DQL80_RS04275 WP_111680167.1 854242..854712(+) (ssbA) [Staphylococcus aureus strain NCTC8726]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1135588 DQL80_RS04275 WP_111680167.1 854242..854712(+) (ssbA) [Staphylococcus aureus strain NCTC8726]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.192

100

0.66

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

67.949

0.41

  ssb Glaesserella parasuis strain SC1401

33.333

100

0.378

  ssb Vibrio cholerae strain A1552

31.492

100

0.365


Multiple sequence alignment