Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | H1W95_RS09950 | Genome accession | NZ_LR822030 |
| Coordinates | 275056..275265 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1046 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 270056..280265
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1W95_RS01465 (STHERMO_0305) | - | 270494..271003 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| H1W95_RS01470 (STHERMO_0306) | - | 271315..271872 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| H1W95_RS01475 (STHERMO_0307) | - | 271875..272525 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| H1W95_RS01480 (STHERMO_0309) | comR | 272720..273619 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| H1W95_RS09940 | - | 273857..274288 (+) | 432 | Protein_250 | cysteine peptidase family C39 domain-containing protein | - |
| H1W95_RS09945 | - | 274318..275034 (+) | 717 | Protein_251 | ABC transporter transmembrane domain-containing protein | - |
| H1W95_RS09950 (STHERMO_0314) | comA | 275056..275265 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| H1W95_RS01500 (STHERMO_0316) | - | 275320..275888 (+) | 569 | Protein_253 | ATP-binding cassette domain-containing protein | - |
| H1W95_RS01505 (STHERMO_0317) | - | 275996..276313 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| H1W95_RS09955 (STHERMO_0318) | - | 276276..276560 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| H1W95_RS09960 (STHERMO_0320) | - | 276800..277696 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| H1W95_RS01515 (STHERMO_0321) | - | 278101..278616 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| H1W95_RS01520 (STHERMO_0322) | - | 278641..278943 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| H1W95_RS01525 (STHERMO_0323) | - | 278955..279266 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=1131495 H1W95_RS09950 WP_002946147.1 275056..275265(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1046]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=1131495 H1W95_RS09950 WP_002946147.1 275056..275265(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1046]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |