Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | H1W89_RS09670 | Genome accession | NZ_LR822029 |
| Coordinates | 280402..280611 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1035 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 275402..285611
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1W89_RS01510 (STHERMO_0290) | - | 275840..276349 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| H1W89_RS01515 (STHERMO_0291) | - | 276661..277218 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| H1W89_RS01520 (STHERMO_0292) | - | 277221..277871 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| H1W89_RS01525 (STHERMO_0293) | comR | 278066..278965 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| H1W89_RS09660 | - | 279203..279634 (+) | 432 | Protein_248 | cysteine peptidase family C39 domain-containing protein | - |
| H1W89_RS09665 | - | 279664..280329 (+) | 666 | Protein_249 | ABC transporter transmembrane domain-containing protein | - |
| H1W89_RS09670 (STHERMO_0298) | comA | 280402..280611 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| H1W89_RS01545 (STHERMO_0300) | - | 280666..281234 (+) | 569 | Protein_251 | ATP-binding cassette domain-containing protein | - |
| H1W89_RS01550 (STHERMO_0301) | - | 281342..281659 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| H1W89_RS09675 (STHERMO_0302) | - | 281622..281906 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| H1W89_RS09680 (STHERMO_0304) | - | 282146..283042 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| H1W89_RS01560 (STHERMO_0305) | - | 283447..283962 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| H1W89_RS01565 (STHERMO_0306) | - | 283987..284289 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| H1W89_RS01570 (STHERMO_0307) | - | 284301..284612 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=1131435 H1W89_RS09670 WP_002946147.1 280402..280611(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1035]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=1131435 H1W89_RS09670 WP_002946147.1 280402..280611(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1035]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |