Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | H0503_RS09685 | Genome accession | NZ_LR822009 |
| Coordinates | 262633..262842 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_19 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257633..267842
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H0503_RS01375 (STHERMO_0290) | - | 258071..258580 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| H0503_RS01380 (STHERMO_0291) | - | 258892..259449 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| H0503_RS01385 (STHERMO_0292) | - | 259452..260102 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| H0503_RS01390 (STHERMO_0293) | comR | 260297..261196 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| H0503_RS09675 | - | 261434..261865 (+) | 432 | Protein_240 | cysteine peptidase family C39 domain-containing protein | - |
| H0503_RS09680 | - | 261895..262560 (+) | 666 | Protein_241 | ABC transporter transmembrane domain-containing protein | - |
| H0503_RS09685 (STHERMO_0298) | comA | 262633..262842 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| H0503_RS01410 (STHERMO_0300) | - | 262897..263465 (+) | 569 | Protein_243 | ATP-binding cassette domain-containing protein | - |
| H0503_RS01415 (STHERMO_0301) | - | 263573..263890 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| H0503_RS09695 (STHERMO_0304) | - | 264377..265273 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| H0503_RS01425 (STHERMO_0305) | - | 265678..266193 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| H0503_RS01430 (STHERMO_0306) | - | 266218..266520 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| H0503_RS01435 (STHERMO_0307) | - | 266532..266843 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=1130585 H0503_RS09685 WP_002946147.1 262633..262842(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_19]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=1130585 H0503_RS09685 WP_002946147.1 262633..262842(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_19]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |