Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   EL264_RS00955 Genome accession   NZ_LR134519
Coordinates   195365..195478 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain NCTC12823     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 190365..200478
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL264_RS00930 (NCTC12823_00188) - 190418..192643 (+) 2226 WP_126473959.1 AAA family ATPase -
  EL264_RS00935 (NCTC12823_00189) panD 192633..192986 (+) 354 WP_024368743.1 aspartate 1-decarboxylase -
  EL264_RS00940 (NCTC12823_00190) - 192989..193291 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  EL264_RS00945 (NCTC12823_00191) - 193291..194286 (+) 996 WP_126474832.1 PDZ domain-containing protein -
  EL264_RS00950 (NCTC12823_00192) comB6 194294..195349 (+) 1056 WP_126474831.1 P-type conjugative transfer protein TrbL Machinery gene
  EL264_RS00955 (NCTC12823_00193) comB7 195365..195478 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  EL264_RS00960 (NCTC12823_00194) comB8 195475..196218 (+) 744 WP_126473961.1 type IV secretion system protein Machinery gene
  EL264_RS00965 (NCTC12823_00195) comB9 196218..197201 (+) 984 WP_126473963.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EL264_RS00970 (NCTC12823_00196) comB10 197194..198324 (+) 1131 WP_126473965.1 DNA type IV secretion system protein ComB10 Machinery gene
  EL264_RS00975 (NCTC12823_00197) - 198394..199806 (+) 1413 WP_126473967.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=1123778 EL264_RS00955 WP_001217873.1 195365..195478(+) (comB7) [Helicobacter pylori strain NCTC12823]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1123778 EL264_RS00955 WP_001217873.1 195365..195478(+) (comB7) [Helicobacter pylori strain NCTC12823]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment