Detailed information NTG1111663

Bioinformatically predicted

Overview

• Name: comYF
• Type: Machinery gene
• Locus tag: HMPREF9319_RS00410
• Genome accession: NZ_GL397128
• Coordinates: 71990..72427 (+)
• Length: 145 a.a.
• NCBI ID: WP_041974065.1
• Uniprot ID: A0AAW6YJ42
• Organism: Streptococcus equinus ATCC 700338
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 66990..77427

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HMPREF9319_RS00380 (HMPREF9319_0069)	-	68710..69072 (+)	363	WP_003062916.1	DUF1033 family protein	-
HMPREF9319_RS00385 (HMPREF9319_0070)	comYA	69143..70084 (+)	942	WP_003062917.1	competence type IV pilus ATPase ComGA	Machinery gene
HMPREF9319_RS00390 (HMPREF9319_0071)	comYB	70008..71051 (+)	1044	WP_003062919.1	competence type IV pilus assembly protein ComGB	Machinery gene
HMPREF9319_RS00395 (HMPREF9319_0072)	comYC	71051..71344 (+)	294	WP_003062921.1	competence type IV pilus major pilin ComGC	Machinery gene
HMPREF9319_RS00400 (HMPREF9319_0073)	comYD	71328..71759 (+)	432	WP_003062922.1	competence type IV pilus minor pilin ComGD	Machinery gene
HMPREF9319_RS00405 (HMPREF9319_0074)	comGE	71713..72006 (+)	294	WP_080543606.1	competence type IV pilus minor pilin ComGE	-
HMPREF9319_RS00410 (HMPREF9319_0075)	comYF	71990..72427 (+)	438	WP_041974065.1	competence type IV pilus minor pilin ComGF	Machinery gene
HMPREF9319_RS00415 (HMPREF9319_0076)	comYG	72399..72731 (+)	333	WP_003062925.1	competence type IV pilus minor pilin ComGG	Machinery gene
HMPREF9319_RS00420 (HMPREF9319_0077)	comYH	72786..73757 (+)	972	WP_003062926.1	class I SAM-dependent methyltransferase	Machinery gene
HMPREF9319_RS00425 (HMPREF9319_0078)	-	73795..74994 (+)	1200	WP_003062927.1	acetate kinase	-
HMPREF9319_RS00430 (HMPREF9319_0079)	-	75155..75355 (+)	201	WP_013851401.1	helix-turn-helix transcriptional regulator	-
HMPREF9319_RS00435 (HMPREF9319_0080)	-	75365..75574 (+)	210	WP_003062929.1	hypothetical protein	-
HMPREF9319_RS00440 (HMPREF9319_0081)	-	75587..76039 (+)	453	WP_003062930.1	hypothetical protein	-
HMPREF9319_RS00445 (HMPREF9319_0082)	-	76051..76689 (+)	639	WP_003062931.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16184.48 Da
• Isoelectric Point: 8.4590

>NTDB_id=1111663 HMPREF9319_RS00410 WP_041974065.1 71990..72427(+) (comYF) [Streptococcus equinus ATCC 700338]
MLKKTSLKAFTLIECLVSLLVISGAILVYNGLTQSISANVHYLSENQEENWLLFSQQLRAELANCQLDKVENNKLYVTKS
SQKLAFGQSKADDFRKTNASGQGYQPMIFGVRSSAISRDGQKVTMTLTLENGLERTFVYTFETAS

Nucleotide

• Length: 438 bp

>NTDB_id=1111663 HMPREF9319_RS00410 WP_041974065.1 71990..72427(+) (comYF) [Streptococcus equinus ATCC 700338]
ATGTTAAAAAAGACTAGTTTAAAGGCATTCACCCTCATAGAATGTTTGGTTTCTTTATTGGTAATTTCGGGTGCTATTCT
TGTTTACAATGGCTTAACGCAATCTATTTCTGCAAATGTGCATTATTTGTCGGAAAATCAAGAGGAAAACTGGCTTTTGT
TTTCACAACAGCTGCGTGCGGAACTTGCCAATTGTCAATTAGATAAGGTTGAAAATAACAAGCTATATGTGACGAAGTCC
AGTCAAAAGTTGGCATTTGGACAGTCAAAGGCTGATGATTTTCGTAAAACAAACGCATCTGGTCAAGGCTATCAGCCAAT
GATATTTGGAGTAAGATCTTCTGCTATTTCTAGAGATGGTCAGAAGGTGACAATGACATTGACTTTAGAGAATGGTTTGG
AGAGGACATTTGTTTACACTTTTGAAACGGCAAGTTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (41-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYF	Streptococcus mutans UA140	58.273	95.862	0.559
comYF	Streptococcus mutans UA159	57.554	95.862	0.552
comGF/cglF	Streptococcus pneumoniae Rx1	45	96.552	0.434
comGF/cglF	Streptococcus pneumoniae D39	45	96.552	0.434
comGF/cglF	Streptococcus pneumoniae R6	45	96.552	0.434
comGF/cglF	Streptococcus pneumoniae TIGR4	45	96.552	0.434
comGF/cglF	Streptococcus mitis NCTC 12261	43.662	97.931	0.428
comGF/cglF	Streptococcus mitis SK321	42.958	97.931	0.421
comGF	Lactococcus lactis subsp. cremoris KW2	43.478	95.172	0.414