Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACN9KP_RS12055 Genome accession   NZ_CP183947
Coordinates   2489116..2489553 (-) Length   145 a.a.
NCBI ID   WP_044053464.1    Uniprot ID   -
Organism   Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2484116..2494553
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN9KP_RS12005 (ACN9KP_12005) sinI 2484500..2484673 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACN9KP_RS12010 (ACN9KP_12010) sinR 2484707..2485042 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACN9KP_RS12015 (ACN9KP_12015) tasA 2485090..2485875 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACN9KP_RS12020 (ACN9KP_12020) sipW 2485939..2486523 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACN9KP_RS12025 (ACN9KP_12025) tapA 2486495..2487166 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  ACN9KP_RS12030 (ACN9KP_12030) - 2487426..2487755 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACN9KP_RS12035 (ACN9KP_12035) - 2487795..2487974 (-) 180 WP_003153093.1 YqzE family protein -
  ACN9KP_RS12040 (ACN9KP_12040) comGG 2488031..2488408 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACN9KP_RS12045 (ACN9KP_12045) comGF 2488409..2488804 (-) 396 WP_283002417.1 competence type IV pilus minor pilin ComGF -
  ACN9KP_RS12050 (ACN9KP_12050) comGE 2488818..2489132 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACN9KP_RS12055 (ACN9KP_12055) comGD 2489116..2489553 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACN9KP_RS12060 (ACN9KP_12060) comGC 2489543..2489851 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACN9KP_RS12065 (ACN9KP_12065) comGB 2489856..2490893 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACN9KP_RS12070 (ACN9KP_12070) comGA 2490880..2491950 (-) 1071 WP_044053465.1 competence type IV pilus ATPase ComGA Machinery gene
  ACN9KP_RS12075 (ACN9KP_12075) - 2492142..2493092 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  ACN9KP_RS12080 (ACN9KP_12080) - 2493238..2494539 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.3354

>NTDB_id=1107318 ACN9KP_RS12055 WP_044053464.1 2489116..2489553(-) (comGD) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1107318 ACN9KP_RS12055 WP_044053464.1 2489116..2489553(-) (comGD) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566


Multiple sequence alignment