Detailed information NTG1107316

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: ACN9KP_RS12040
• Genome accession: NZ_CP183947
• Coordinates: 2488031..2488408 (-)
• Length: 125 a.a.
• NCBI ID: WP_014305410.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2483031..2493408

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACN9KP_RS12000 (ACN9KP_12000)	-	2483529..2484323 (+)	795	WP_003153106.1	YqhG family protein	-
ACN9KP_RS12005 (ACN9KP_12005)	sinI	2484500..2484673 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACN9KP_RS12010 (ACN9KP_12010)	sinR	2484707..2485042 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACN9KP_RS12015 (ACN9KP_12015)	tasA	2485090..2485875 (-)	786	WP_003153102.1	biofilm matrix protein TasA	-
ACN9KP_RS12020 (ACN9KP_12020)	sipW	2485939..2486523 (-)	585	WP_012117977.1	signal peptidase I SipW	-
ACN9KP_RS12025 (ACN9KP_12025)	tapA	2486495..2487166 (-)	672	WP_024085598.1	amyloid fiber anchoring/assembly protein TapA	-
ACN9KP_RS12030 (ACN9KP_12030)	-	2487426..2487755 (+)	330	WP_003153097.1	DUF3889 domain-containing protein	-
ACN9KP_RS12035 (ACN9KP_12035)	-	2487795..2487974 (-)	180	WP_003153093.1	YqzE family protein	-
ACN9KP_RS12040 (ACN9KP_12040)	comGG	2488031..2488408 (-)	378	WP_014305410.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACN9KP_RS12045 (ACN9KP_12045)	comGF	2488409..2488804 (-)	396	WP_283002417.1	competence type IV pilus minor pilin ComGF	-
ACN9KP_RS12050 (ACN9KP_12050)	comGE	2488818..2489132 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACN9KP_RS12055 (ACN9KP_12055)	comGD	2489116..2489553 (-)	438	WP_044053464.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACN9KP_RS12060 (ACN9KP_12060)	comGC	2489543..2489851 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACN9KP_RS12065 (ACN9KP_12065)	comGB	2489856..2490893 (-)	1038	WP_024085602.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACN9KP_RS12070 (ACN9KP_12070)	comGA	2490880..2491950 (-)	1071	WP_044053465.1	competence type IV pilus ATPase ComGA	Machinery gene
ACN9KP_RS12075 (ACN9KP_12075)	-	2492142..2493092 (-)	951	WP_014305415.1	magnesium transporter CorA family protein	-

Sequence

Protein

• Length: 125 a.a.
• Molecular weight: 14170.14 Da
• Isoelectric Point: 9.9592

>NTDB_id=1107316 ACN9KP_RS12040 WP_014305410.1 2488031..2488408(-) (comGG) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide

• Length: 378 bp

>NTDB_id=1107316 ACN9KP_RS12040 WP_014305410.1 2488031..2488408(-) (comGG) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

• ComG operon protein 7 (ComGG) (30-124)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Bacillus subtilis subsp. subtilis str. 168	51.613	99.2	0.512