Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACN9KP_RS12005 | Genome accession | NZ_CP183947 |
| Coordinates | 2484500..2484673 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2479500..2489673
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACN9KP_RS11990 (ACN9KP_11990) | gcvT | 2480318..2481418 (-) | 1101 | WP_044053463.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACN9KP_RS11995 (ACN9KP_11995) | - | 2481841..2483511 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACN9KP_RS12000 (ACN9KP_12000) | - | 2483529..2484323 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACN9KP_RS12005 (ACN9KP_12005) | sinI | 2484500..2484673 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACN9KP_RS12010 (ACN9KP_12010) | sinR | 2484707..2485042 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACN9KP_RS12015 (ACN9KP_12015) | tasA | 2485090..2485875 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACN9KP_RS12020 (ACN9KP_12020) | sipW | 2485939..2486523 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACN9KP_RS12025 (ACN9KP_12025) | tapA | 2486495..2487166 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACN9KP_RS12030 (ACN9KP_12030) | - | 2487426..2487755 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACN9KP_RS12035 (ACN9KP_12035) | - | 2487795..2487974 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACN9KP_RS12040 (ACN9KP_12040) | comGG | 2488031..2488408 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACN9KP_RS12045 (ACN9KP_12045) | comGF | 2488409..2488804 (-) | 396 | WP_283002417.1 | competence type IV pilus minor pilin ComGF | - |
| ACN9KP_RS12050 (ACN9KP_12050) | comGE | 2488818..2489132 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACN9KP_RS12055 (ACN9KP_12055) | comGD | 2489116..2489553 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1107314 ACN9KP_RS12005 WP_003153105.1 2484500..2484673(+) (sinI) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1107314 ACN9KP_RS12005 WP_003153105.1 2484500..2484673(+) (sinI) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |