Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinR   Type   Regulator
Locus tag   ACN9KP_RS12010 Genome accession   NZ_CP183947
Coordinates   2484707..2485042 (+) Length   111 a.a.
NCBI ID   WP_003153104.1    Uniprot ID   -
Organism   Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Genomic Context

Location: 2479707..2490042
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN9KP_RS11990 (ACN9KP_11990) gcvT 2480318..2481418 (-) 1101 WP_044053463.1 glycine cleavage system aminomethyltransferase GcvT -
  ACN9KP_RS11995 (ACN9KP_11995) - 2481841..2483511 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ACN9KP_RS12000 (ACN9KP_12000) - 2483529..2484323 (+) 795 WP_003153106.1 YqhG family protein -
  ACN9KP_RS12005 (ACN9KP_12005) sinI 2484500..2484673 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACN9KP_RS12010 (ACN9KP_12010) sinR 2484707..2485042 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACN9KP_RS12015 (ACN9KP_12015) tasA 2485090..2485875 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACN9KP_RS12020 (ACN9KP_12020) sipW 2485939..2486523 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACN9KP_RS12025 (ACN9KP_12025) tapA 2486495..2487166 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  ACN9KP_RS12030 (ACN9KP_12030) - 2487426..2487755 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACN9KP_RS12035 (ACN9KP_12035) - 2487795..2487974 (-) 180 WP_003153093.1 YqzE family protein -
  ACN9KP_RS12040 (ACN9KP_12040) comGG 2488031..2488408 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACN9KP_RS12045 (ACN9KP_12045) comGF 2488409..2488804 (-) 396 WP_283002417.1 competence type IV pilus minor pilin ComGF -
  ACN9KP_RS12050 (ACN9KP_12050) comGE 2488818..2489132 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACN9KP_RS12055 (ACN9KP_12055) comGD 2489116..2489553 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACN9KP_RS12060 (ACN9KP_12060) comGC 2489543..2489851 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene

Sequence

Protein


Download         Length: 111 a.a.        Molecular weight: 12972.64 Da        Isoelectric Point: 7.2023

>NTDB_id=1107315 ACN9KP_RS12010 WP_003153104.1 2484707..2485042(+) (sinR) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEK
LVRDAMTSGVSKKQFREFLDYQKWRKAQKEE

Nucleotide


Download         Length: 336 bp        

>NTDB_id=1107315 ACN9KP_RS12010 WP_003153104.1 2484707..2485042(+) (sinR) [Bacillus velezensis strain Ya-1 isolate Tropical rainforest soil]
TTGATTGGCCAGCGTATTAAACAATACCGAAAAGAAAAAGGCTACTCACTATCAGAACTAGCTGAAAAAGCTGGGGTAGC
GAAGTCTTATTTAAGCTCAATAGAACGAAATTTACAGACGAACCCCTCCATTCAATTTCTCGAAAAAGTCTCCGCTGTTC
TGGACGTCTCGGTTCATACTTTACTTGATGAAAAACATGAAACCGAATACGATGGTCAATTAGATAGTGAATGGGAGAAA
TTAGTTCGCGATGCGATGACATCCGGGGTATCAAAAAAACAATTTCGTGAATTTTTAGATTATCAAAAATGGAGAAAAGC
GCAAAAAGAGGAGTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(6-58)

Anti-repressor SinI (SinI)

(74-101)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

99.099

100

0.991

Multiple sequence alignment