Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ACN6IU_RS13125 Genome accession   NZ_CP183804
Coordinates   2573892..2574320 (-) Length   142 a.a.
NCBI ID   WP_238300491.1    Uniprot ID   -
Organism   Pasteurella multocida strain 171865     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2549085..2596461 2573892..2574320 within 0


Gene organization within MGE regions


Location: 2549085..2596461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN6IU_RS13010 - 2549085..2550518 (-) 1434 WP_005756857.1 glycosyltransferase family 2 protein -
  ACN6IU_RS13015 - 2550511..2551683 (-) 1173 WP_014326099.1 nucleotide sugar dehydrogenase -
  ACN6IU_RS13020 - 2551747..2554665 (-) 2919 WP_016504510.1 glycosyltransferase family 2 protein -
  ACN6IU_RS13025 - 2554683..2556551 (-) 1869 WP_014326097.1 protein HyaE -
  ACN6IU_RS13030 tnpA 2556772..2557188 (-) 417 WP_005720092.1 IS200/IS605 family transposase -
  ACN6IU_RS13035 - 2557235..2558371 (+) 1137 WP_139616922.1 RNA-guided endonuclease InsQ/TnpB family protein -
  ACN6IU_RS13040 - 2558657..2560714 (+) 2058 WP_014326096.1 capsular polysaccharide biosynthesis protein -
  ACN6IU_RS13045 - 2560724..2561950 (+) 1227 WP_016533042.1 capsule biosynthesis protein -
  ACN6IU_RS13050 - 2561986..2562438 (+) 453 WP_005716569.1 DUF441 domain-containing protein -
  ACN6IU_RS13055 - 2562460..2562843 (+) 384 WP_005754194.1 DUF423 domain-containing protein -
  ACN6IU_RS13060 hrpA 2562843..2566754 (+) 3912 WP_016504499.1 ATP-dependent RNA helicase HrpA -
  ACN6IU_RS13070 - 2567435..2568745 (+) 1311 WP_419731331.1 integrase arm-type DNA-binding domain-containing protein -
  ACN6IU_RS13075 - 2568726..2568902 (-) 177 WP_169326193.1 helix-turn-helix domain-containing protein -
  ACN6IU_RS13080 - 2569117..2569305 (-) 189 WP_238300505.1 hypothetical protein -
  ACN6IU_RS13085 - 2569308..2569751 (-) 444 WP_238300502.1 pyruvate kinase -
  ACN6IU_RS13090 - 2569837..2570142 (-) 306 WP_238300500.1 hypothetical protein -
  ACN6IU_RS13095 - 2570154..2570651 (-) 498 WP_238300498.1 DUF551 domain-containing protein -
  ACN6IU_RS13100 - 2570654..2571139 (-) 486 WP_078737840.1 methyltransferase -
  ACN6IU_RS13105 - 2571199..2571642 (-) 444 WP_238300496.1 hypothetical protein -
  ACN6IU_RS13110 - 2571963..2572562 (-) 600 WP_238300493.1 hypothetical protein -
  ACN6IU_RS13115 - 2572617..2573405 (-) 789 WP_064964852.1 DUF2303 family protein -
  ACN6IU_RS13120 - 2573477..2573830 (-) 354 WP_016570064.1 hypothetical protein -
  ACN6IU_RS13125 ssb 2573892..2574320 (-) 429 WP_238300491.1 single-stranded DNA-binding protein Machinery gene
  ACN6IU_RS13130 - 2574321..2574596 (-) 276 WP_238300489.1 hypothetical protein -
  ACN6IU_RS13135 - 2574658..2575032 (-) 375 WP_238300486.1 hypothetical protein -
  ACN6IU_RS13145 - 2576146..2576322 (-) 177 WP_169326206.1 hypothetical protein -
  ACN6IU_RS13150 - 2576543..2577448 (+) 906 WP_078819886.1 type VI secretion system-associated protein TagO -
  ACN6IU_RS13155 - 2577517..2578293 (-) 777 WP_238300485.1 LexA family transcriptional regulator -
  ACN6IU_RS13160 - 2578421..2578606 (+) 186 WP_046339050.1 Cro/CI family transcriptional regulator -
  ACN6IU_RS13165 - 2578655..2579104 (+) 450 WP_078819884.1 YmfL family putative regulatory protein -
  ACN6IU_RS13170 - 2579163..2579915 (+) 753 WP_238300483.1 Rha family transcriptional regulator -
  ACN6IU_RS13175 - 2579912..2580982 (+) 1071 WP_238300481.1 conserved phage C-terminal domain-containing protein -
  ACN6IU_RS13180 - 2580991..2581524 (+) 534 WP_238300556.1 phage N-6-adenine-methyltransferase -
  ACN6IU_RS13185 - 2581521..2582510 (+) 990 WP_238300479.1 DUF968 domain-containing protein -
  ACN6IU_RS13190 - 2582510..2582884 (+) 375 WP_046339056.1 RusA family crossover junction endodeoxyribonuclease -
  ACN6IU_RS13195 - 2582871..2583257 (+) 387 WP_167829995.1 antiterminator Q family protein -
  ACN6IU_RS13200 - 2583410..2583775 (+) 366 WP_238300477.1 phage holin, lambda family -
  ACN6IU_RS13205 - 2583747..2584331 (+) 585 WP_238300475.1 glycoside hydrolase family 19 protein -
  ACN6IU_RS13210 - 2584334..2584657 (+) 324 WP_238300473.1 DUF2570 family protein -
  ACN6IU_RS13215 lysC 2584563..2584844 (+) 282 WP_410878439.1 hypothetical protein -
  ACN6IU_RS13220 - 2584869..2585237 (-) 369 WP_014391478.1 helix-turn-helix domain-containing protein -
  ACN6IU_RS13225 - 2585274..2585534 (-) 261 WP_005720780.1 type II toxin-antitoxin system RelE family toxin -
  ACN6IU_RS13230 - 2585825..2586301 (+) 477 WP_419731332.1 DUF1441 family protein -
  ACN6IU_RS13235 - 2586304..2588412 (+) 2109 WP_238300231.1 phage terminase large subunit family protein -
  ACN6IU_RS13240 - 2588409..2588630 (+) 222 WP_014391481.1 hypothetical protein -
  ACN6IU_RS13245 - 2588627..2590165 (+) 1539 WP_238300232.1 phage portal protein -
  ACN6IU_RS13250 - 2590101..2592119 (+) 2019 WP_238300233.1 ClpP-like prohead protease/major capsid protein fusion protein -
  ACN6IU_RS13255 - 2592190..2592516 (+) 327 WP_016570083.1 DUF2190 family protein -
  ACN6IU_RS13260 - 2592509..2592802 (+) 294 WP_005719722.1 hypothetical protein -
  ACN6IU_RS13265 - 2592802..2593353 (+) 552 WP_223131947.1 phage tail protein -
  ACN6IU_RS13270 gpU 2593350..2593757 (+) 408 WP_223131948.1 phage minor tail U family protein -
  ACN6IU_RS13275 - 2593754..2594263 (+) 510 WP_115098329.1 phage tail tube protein -
  ACN6IU_RS13280 - 2594266..2594655 (+) 390 WP_061406079.1 phage minor tail protein G -
  ACN6IU_RS13285 tnpA 2594862..2595278 (-) 417 WP_005720092.1 IS200/IS605 family transposase -
  ACN6IU_RS13290 - 2595325..2596461 (+) 1137 WP_139616922.1 RNA-guided endonuclease InsQ/TnpB family protein -

Sequence

Protein


Download         Length: 142 a.a.        Molecular weight: 15938.84 Da        Isoelectric Point: 6.7216

>NTDB_id=1106202 ACN6IU_RS13125 WP_238300491.1 2573892..2574320(-) (ssb) [Pasteurella multocida strain 171865]
MAGVNKVIIVGNLGQDPDHKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITLYRRQADIAAQFLKKGSKVYIEG
RLRTRKWQDQSGQERYITEIIADKIVLLDSKQTSGTGNSNPPPEQQQHDPYGDAFNCDNIPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=1106202 ACN6IU_RS13125 WP_238300491.1 2573892..2574320(-) (ssb) [Pasteurella multocida strain 171865]
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGACAAGACCCAGATCACAAAGTAATGACAAATGGCGATCC
CGTGACCAATATCAGCGTGGCCACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAACGCGAAGTTGTCGAATGGC
ACCGTATTACGCTATATCGACGACAAGCAGATATTGCCGCGCAGTTTTTGAAAAAAGGCTCAAAAGTCTATATTGAAGGT
CGTTTGCGAACTCGAAAATGGCAAGATCAAAGCGGACAAGAGCGATACATCACAGAAATTATCGCTGATAAAATCGTCTT
ACTTGATAGCAAGCAGACTTCAGGCACTGGCAATAGCAATCCACCACCGGAACAACAGCAACATGATCCGTATGGTGACG
CATTTAATTGTGACAATATTCCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

66.087

80.986

0.535
  ssb Neisseria meningitidis MC58

43.662

100

0.437
  ssb Vibrio cholerae strain A1552

62.626

69.718

0.437
  ssb Neisseria gonorrhoeae MS11

47.368

80.282

0.38

Multiple sequence alignment