Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACNM63_RS11850 Genome accession   NZ_CP183191
Coordinates   2466756..2467070 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain QC02     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2461756..2472070
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNM63_RS11805 (ACNM63_11805) sinI 2462437..2462610 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACNM63_RS11810 (ACNM63_11810) sinR 2462644..2462979 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNM63_RS11815 (ACNM63_11815) tasA 2463027..2463812 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACNM63_RS11820 (ACNM63_11820) sipW 2463877..2464461 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACNM63_RS11825 (ACNM63_11825) tapA 2464433..2465104 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACNM63_RS11830 (ACNM63_11830) - 2465363..2465692 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACNM63_RS11835 (ACNM63_11835) - 2465733..2465912 (-) 180 WP_003153093.1 YqzE family protein -
  ACNM63_RS11840 (ACNM63_11840) comGG 2465969..2466346 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNM63_RS11845 (ACNM63_11845) comGF 2466347..2466742 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ACNM63_RS11850 (ACNM63_11850) comGE 2466756..2467070 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACNM63_RS11855 (ACNM63_11855) comGD 2467054..2467491 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACNM63_RS11860 (ACNM63_11860) comGC 2467481..2467789 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ACNM63_RS11865 (ACNM63_11865) comGB 2467794..2468831 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACNM63_RS11870 (ACNM63_11870) comGA 2468818..2469888 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  ACNM63_RS11875 (ACNM63_11875) - 2470081..2471031 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=1104380 ACNM63_RS11850 WP_017418140.1 2466756..2467070(-) (comGE) [Bacillus velezensis strain QC02]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1104380 ACNM63_RS11850 WP_017418140.1 2466756..2467070(-) (comGE) [Bacillus velezensis strain QC02]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment