Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACNM63_RS11805 Genome accession   NZ_CP183191
Coordinates   2462437..2462610 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain QC02     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2457437..2467610
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNM63_RS11790 (ACNM63_11790) gcvT 2458250..2459350 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  ACNM63_RS11795 (ACNM63_11795) - 2459774..2461444 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  ACNM63_RS11800 (ACNM63_11800) - 2461466..2462260 (+) 795 WP_014418368.1 YqhG family protein -
  ACNM63_RS11805 (ACNM63_11805) sinI 2462437..2462610 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACNM63_RS11810 (ACNM63_11810) sinR 2462644..2462979 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNM63_RS11815 (ACNM63_11815) tasA 2463027..2463812 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACNM63_RS11820 (ACNM63_11820) sipW 2463877..2464461 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACNM63_RS11825 (ACNM63_11825) tapA 2464433..2465104 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACNM63_RS11830 (ACNM63_11830) - 2465363..2465692 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACNM63_RS11835 (ACNM63_11835) - 2465733..2465912 (-) 180 WP_003153093.1 YqzE family protein -
  ACNM63_RS11840 (ACNM63_11840) comGG 2465969..2466346 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNM63_RS11845 (ACNM63_11845) comGF 2466347..2466742 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ACNM63_RS11850 (ACNM63_11850) comGE 2466756..2467070 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACNM63_RS11855 (ACNM63_11855) comGD 2467054..2467491 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=1104377 ACNM63_RS11805 WP_014418369.1 2462437..2462610(+) (sinI) [Bacillus velezensis strain QC02]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1104377 ACNM63_RS11805 WP_014418369.1 2462437..2462610(+) (sinI) [Bacillus velezensis strain QC02]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment