Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACNM63_RS11805 | Genome accession | NZ_CP183191 |
| Coordinates | 2462437..2462610 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain QC02 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2457437..2467610
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACNM63_RS11790 (ACNM63_11790) | gcvT | 2458250..2459350 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACNM63_RS11795 (ACNM63_11795) | - | 2459774..2461444 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| ACNM63_RS11800 (ACNM63_11800) | - | 2461466..2462260 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| ACNM63_RS11805 (ACNM63_11805) | sinI | 2462437..2462610 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| ACNM63_RS11810 (ACNM63_11810) | sinR | 2462644..2462979 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACNM63_RS11815 (ACNM63_11815) | tasA | 2463027..2463812 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACNM63_RS11820 (ACNM63_11820) | sipW | 2463877..2464461 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACNM63_RS11825 (ACNM63_11825) | tapA | 2464433..2465104 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACNM63_RS11830 (ACNM63_11830) | - | 2465363..2465692 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACNM63_RS11835 (ACNM63_11835) | - | 2465733..2465912 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACNM63_RS11840 (ACNM63_11840) | comGG | 2465969..2466346 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACNM63_RS11845 (ACNM63_11845) | comGF | 2466347..2466742 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| ACNM63_RS11850 (ACNM63_11850) | comGE | 2466756..2467070 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACNM63_RS11855 (ACNM63_11855) | comGD | 2467054..2467491 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=1104377 ACNM63_RS11805 WP_014418369.1 2462437..2462610(+) (sinI) [Bacillus velezensis strain QC02]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1104377 ACNM63_RS11805 WP_014418369.1 2462437..2462610(+) (sinI) [Bacillus velezensis strain QC02]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |