Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACM6AK_RS05310 Genome accession   NZ_CP181109
Coordinates   1101304..1101774 (+) Length   156 a.a.
NCBI ID   WP_086038227.1    Uniprot ID   -
Organism   Staphylococcus aureus strain AG21-0611     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1085852..1134550 1101304..1101774 within 0


Gene organization within MGE regions


Location: 1085852..1134550
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM6AK_RS05185 (ACM6AK_05185) - 1085852..1086778 (-) 927 WP_000757575.1 glycerophosphodiester phosphodiesterase -
  ACM6AK_RS05190 (ACM6AK_05190) - 1087017..1087271 (+) 255 WP_001049150.1 YlbG family protein -
  ACM6AK_RS05195 (ACM6AK_05195) - 1087274..1087663 (-) 390 WP_000814565.1 hypothetical protein -
  ACM6AK_RS05200 (ACM6AK_05200) rsmD 1087733..1088275 (+) 543 WP_001263796.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  ACM6AK_RS05205 (ACM6AK_05205) coaD 1088277..1088759 (+) 483 WP_000401377.1 pantetheine-phosphate adenylyltransferase -
  ACM6AK_RS05210 (ACM6AK_05210) - 1088821..1089960 (-) 1140 WP_000843611.1 nucleotidyltransferase -
  ACM6AK_RS05215 (ACM6AK_05215) - 1090087..1090644 (+) 558 WP_000872158.1 YceD family protein -
  ACM6AK_RS05220 (ACM6AK_05220) rpmF 1090724..1090897 (+) 174 WP_000290472.1 50S ribosomal protein L32 -
  ACM6AK_RS05225 (ACM6AK_05225) - 1091014..1092399 (-) 1386 WP_000861313.1 recombinase family protein -
  ACM6AK_RS05230 (ACM6AK_05230) - 1092606..1093286 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  ACM6AK_RS05235 (ACM6AK_05235) - 1093470..1093931 (-) 462 WP_000525011.1 hypothetical protein -
  ACM6AK_RS05240 (ACM6AK_05240) - 1093944..1094267 (-) 324 WP_001260487.1 helix-turn-helix domain-containing protein -
  ACM6AK_RS05245 (ACM6AK_05245) - 1094431..1094679 (+) 249 WP_000272859.1 helix-turn-helix domain-containing protein -
  ACM6AK_RS05250 (ACM6AK_05250) - 1094692..1095135 (+) 444 WP_000435355.1 hypothetical protein -
  ACM6AK_RS05255 (ACM6AK_05255) - 1095150..1095329 (+) 180 WP_000393082.1 hypothetical protein -
  ACM6AK_RS05260 (ACM6AK_05260) - 1095319..1095558 (-) 240 WP_000438628.1 hypothetical protein -
  ACM6AK_RS05265 (ACM6AK_05265) - 1095615..1096358 (+) 744 WP_033861543.1 phage antirepressor KilAC domain-containing protein -
  ACM6AK_RS05270 (ACM6AK_05270) - 1096534..1096764 (-) 231 WP_000395455.1 hypothetical protein -
  ACM6AK_RS05275 (ACM6AK_05275) - 1096823..1096951 (+) 129 WP_001559112.1 hypothetical protein -
  ACM6AK_RS05280 (ACM6AK_05280) - 1096944..1097105 (+) 162 WP_000066026.1 DUF1270 family protein -
  ACM6AK_RS05285 (ACM6AK_05285) - 1097199..1097459 (+) 261 WP_000291091.1 DUF1108 family protein -
  ACM6AK_RS05290 (ACM6AK_05290) - 1097468..1097731 (+) 264 WP_001205732.1 hypothetical protein -
  ACM6AK_RS05295 (ACM6AK_05295) - 1097728..1099683 (+) 1956 WP_049880126.1 AAA family ATPase -
  ACM6AK_RS05300 (ACM6AK_05300) - 1099685..1100605 (+) 921 WP_000138475.1 recombinase RecT -
  ACM6AK_RS05305 (ACM6AK_05305) - 1100686..1101303 (+) 618 WP_077517322.1 MBL fold metallo-hydrolase -
  ACM6AK_RS05310 (ACM6AK_05310) ssbA 1101304..1101774 (+) 471 WP_086038227.1 single-stranded DNA-binding protein Machinery gene
  ACM6AK_RS05315 (ACM6AK_05315) - 1101804..1102688 (+) 885 WP_016047539.1 DnaD domain protein -
  ACM6AK_RS05320 (ACM6AK_05320) - 1102695..1102913 (+) 219 WP_000338528.1 hypothetical protein -
  ACM6AK_RS05325 (ACM6AK_05325) - 1102922..1103326 (+) 405 WP_029052043.1 RusA family crossover junction endodeoxyribonuclease -
  ACM6AK_RS05330 (ACM6AK_05330) - 1103339..1103707 (+) 369 WP_000101275.1 SA1788 family PVL leukocidin-associated protein -
  ACM6AK_RS05335 (ACM6AK_05335) - 1103711..1103953 (+) 243 WP_031833133.1 SAV1978 family virulence-associated passenger protein -
  ACM6AK_RS05340 (ACM6AK_05340) - 1103966..1104370 (+) 405 WP_001560892.1 hypothetical protein -
  ACM6AK_RS05345 (ACM6AK_05345) - 1104367..1104714 (+) 348 WP_000979209.1 YopX family protein -
  ACM6AK_RS05350 (ACM6AK_05350) - 1104711..1105019 (+) 309 WP_031891531.1 hypothetical protein -
  ACM6AK_RS05355 (ACM6AK_05355) - 1105012..1105260 (+) 249 WP_001065062.1 DUF1024 family protein -
  ACM6AK_RS05360 (ACM6AK_05360) - 1105253..1105783 (+) 531 WP_000185662.1 dUTPase -
  ACM6AK_RS05365 (ACM6AK_05365) - 1105820..1106026 (+) 207 WP_016028256.1 DUF1381 domain-containing protein -
  ACM6AK_RS05370 (ACM6AK_05370) rinB 1106023..1106196 (+) 174 WP_000595257.1 transcriptional activator RinB -
  ACM6AK_RS05375 (ACM6AK_05375) - 1106197..1106559 (+) 363 WP_000383791.1 hypothetical protein -
  ACM6AK_RS05380 (ACM6AK_05380) - 1106560..1106706 (+) 147 WP_000989961.1 hypothetical protein -
  ACM6AK_RS05385 (ACM6AK_05385) - 1106721..1107140 (+) 420 WP_000058634.1 transcriptional regulator -
  ACM6AK_RS05390 (ACM6AK_05390) - 1107327..1107767 (+) 441 WP_001003272.1 terminase small subunit -
  ACM6AK_RS05395 (ACM6AK_05395) - 1107754..1109031 (+) 1278 WP_000169945.1 PBSX family phage terminase large subunit -
  ACM6AK_RS05400 (ACM6AK_05400) - 1109042..1110580 (+) 1539 WP_031766723.1 phage portal protein -
  ACM6AK_RS05405 (ACM6AK_05405) - 1110587..1111582 (+) 996 WP_001133044.1 minor capsid protein -
  ACM6AK_RS05410 (ACM6AK_05410) - 1111655..1111825 (+) 171 WP_000072208.1 hypothetical protein -
  ACM6AK_RS05415 (ACM6AK_05415) - 1111853..1111940 (+) 88 Protein_1059 hypothetical protein -
  ACM6AK_RS05420 (ACM6AK_05420) - 1111934..1112554 (+) 621 WP_000392151.1 DUF4355 domain-containing protein -
  ACM6AK_RS05425 (ACM6AK_05425) - 1112568..1113542 (+) 975 WP_000438511.1 phage major capsid protein -
  ACM6AK_RS05430 (ACM6AK_05430) - 1113564..1113851 (+) 288 WP_001114086.1 hypothetical protein -
  ACM6AK_RS05435 (ACM6AK_05435) - 1113860..1114192 (+) 333 WP_000208960.1 phage head-tail connector protein -
  ACM6AK_RS05440 (ACM6AK_05440) - 1114189..1114491 (+) 303 WP_001268312.1 hypothetical protein -
  ACM6AK_RS05445 (ACM6AK_05445) - 1114491..1114838 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  ACM6AK_RS05450 (ACM6AK_05450) - 1114850..1115233 (+) 384 WP_000188643.1 hypothetical protein -
  ACM6AK_RS05455 (ACM6AK_05455) - 1115252..1115833 (+) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  ACM6AK_RS05460 (ACM6AK_05460) - 1115895..1116260 (+) 366 WP_001100161.1 tail assembly chaperone -
  ACM6AK_RS05465 (ACM6AK_05465) - 1116290..1116634 (+) 345 WP_000105584.1 hypothetical protein -
  ACM6AK_RS05470 (ACM6AK_05470) - 1116651..1120115 (+) 3465 WP_086036927.1 hypothetical protein -
  ACM6AK_RS05475 (ACM6AK_05475) - 1120128..1121075 (+) 948 WP_000350687.1 phage tail family protein -
  ACM6AK_RS05480 (ACM6AK_05480) - 1121084..1122985 (+) 1902 WP_000156416.1 SGNH/GDSL hydrolase family protein -
  ACM6AK_RS05485 (ACM6AK_05485) - 1123000..1124910 (+) 1911 WP_000066423.1 hypothetical protein -
  ACM6AK_RS05490 (ACM6AK_05490) - 1124910..1126733 (+) 1824 WP_000259596.1 phage baseplate upper protein -
  ACM6AK_RS05495 (ACM6AK_05495) - 1126733..1127110 (+) 378 WP_000705902.1 DUF2977 domain-containing protein -
  ACM6AK_RS05500 (ACM6AK_05500) - 1127114..1127287 (+) 174 WP_001800921.1 XkdX family protein -
  ACM6AK_RS05505 (ACM6AK_05505) - 1127328..1127627 (+) 300 WP_000466767.1 DUF2951 domain-containing protein -
  ACM6AK_RS05510 (ACM6AK_05510) - 1127764..1129656 (+) 1893 WP_086036928.1 glucosaminidase domain-containing protein -
  ACM6AK_RS05515 (ACM6AK_05515) - 1129669..1130907 (+) 1239 WP_000276662.1 BppU family phage baseplate upper protein -
  ACM6AK_RS05520 (ACM6AK_05520) - 1130913..1131308 (+) 396 WP_000398868.1 hypothetical protein -
  ACM6AK_RS05525 (ACM6AK_05525) - 1131364..1131639 (+) 276 WP_000351119.1 phage holin -
  ACM6AK_RS05530 (ACM6AK_05530) - 1131626..1133038 (+) 1413 WP_001141517.1 N-acetylmuramoyl-L-alanine amidase -
  ACM6AK_RS05535 (ACM6AK_05535) - 1133098..1133655 (-) 558 WP_001035620.1 DUF4888 domain-containing protein -
  ACM6AK_RS05540 (ACM6AK_05540) - 1134030..1134182 (+) 153 WP_001788502.1 hypothetical protein -
  ACM6AK_RS05545 (ACM6AK_05545) - 1134253..1134363 (+) 111 WP_000139423.1 hypothetical protein -
  ACM6AK_RS05550 (ACM6AK_05550) - 1134365..1134550 (+) 186 WP_001286805.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17673.56 Da        Isoelectric Point: 4.9628

>NTDB_id=1098386 ACM6AK_RS05310 WP_086038227.1 1101304..1101774(+) (ssbA) [Staphylococcus aureus strain AG21-0611]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDSQQDVYQQQVQQTRGQSQYPYNKPVKDNPFANANGPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1098386 ACM6AK_RS05310 WP_086038227.1 1101304..1101774(+) (ssbA) [Staphylococcus aureus strain AG21-0611]
ATGATAAATAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATGTATATCAACAACAAGTACAACAAACACGTGGGCAATCGCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTTGCAAATGCTAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

52.941

100

0.577

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

32.948

100

0.365

  ssb Neisseria gonorrhoeae MS11

32.948

100

0.365


Multiple sequence alignment