Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACMXKM_RS07555 Genome accession   NZ_CP180475
Coordinates   1609850..1610293 (+) Length   147 a.a.
NCBI ID   WP_006248858.1    Uniprot ID   -
Organism   Pasteurella multocida strain 200011     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1607631..1660107 1609850..1610293 within 0


Gene organization within MGE regions


Location: 1607631..1660107
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMXKM_RS07545 - 1608260..1609018 (+) 759 WP_230268913.1 PFL_4669 family integrating conjugative element protein -
  ACMXKM_RS07550 - 1609027..1609536 (+) 510 WP_230268914.1 DUF3158 family protein -
  ACMXKM_RS07555 ssb 1609850..1610293 (+) 444 WP_006248858.1 single-stranded DNA-binding protein Machinery gene
  ACMXKM_RS07560 - 1610434..1610829 (+) 396 WP_230268915.1 hypothetical protein -
  ACMXKM_RS07565 - 1610795..1611562 (-) 768 WP_230268916.1 hypothetical protein -
  ACMXKM_RS07570 - 1611680..1612198 (+) 519 WP_230268917.1 hemophilus-specific protein -
  ACMXKM_RS07575 - 1612358..1614409 (+) 2052 WP_230268918.1 DNA topoisomerase III -
  ACMXKM_RS07580 - 1615227..1615667 (+) 441 WP_281130442.1 STY4534 family ICE replication protein -
  ACMXKM_RS07585 - 1615774..1616421 (+) 648 WP_230268919.1 DUF3560 domain-containing protein -
  ACMXKM_RS07590 - 1616444..1616851 (+) 408 WP_230268920.1 heme utilization protein -
  ACMXKM_RS07595 - 1616931..1617293 (+) 363 WP_230268921.1 hypothetical protein -
  ACMXKM_RS07600 - 1617406..1617666 (+) 261 WP_230268922.1 hypothetical protein -
  ACMXKM_RS07605 - 1617825..1618454 (+) 630 WP_230268923.1 hypothetical protein -
  ACMXKM_RS07610 - 1618454..1619227 (+) 774 WP_326845031.1 TIGR03759 family integrating conjugative element protein -
  ACMXKM_RS07615 - 1619206..1619976 (+) 771 WP_230268925.1 lytic transglycosylase domain-containing protein -
  ACMXKM_RS07620 - 1619979..1620485 (+) 507 WP_012340834.1 integrating conjugative element protein -
  ACMXKM_RS07625 traD 1620485..1622689 (+) 2205 WP_230268926.1 type IV conjugative transfer system coupling protein TraD -
  ACMXKM_RS07630 - 1622682..1623035 (+) 354 WP_230268927.1 hemophilus-specific protein -
  ACMXKM_RS07635 - 1623032..1623727 (+) 696 WP_230268928.1 TIGR03747 family integrating conjugative element membrane protein -
  ACMXKM_RS07640 - 1623759..1624130 (-) 372 WP_230268929.1 hypothetical protein -
  ACMXKM_RS07645 - 1624329..1624655 (+) 327 WP_230268930.1 RAQPRD family integrative conjugative element protein -
  ACMXKM_RS07650 - 1624655..1624888 (+) 234 WP_014325829.1 DUF3262 family protein -
  ACMXKM_RS07655 - 1624903..1625292 (+) 390 WP_006248894.1 DUF2976 domain-containing protein -
  ACMXKM_RS07660 - 1625315..1625680 (+) 366 WP_230268931.1 TIGR03750 family conjugal transfer protein -
  ACMXKM_RS07665 - 1625684..1626328 (+) 645 WP_230268932.1 PFL_4703 family integrating conjugative element protein -
  ACMXKM_RS07670 - 1626328..1627212 (+) 885 WP_230268933.1 TIGR03749 family integrating conjugative element protein -
  ACMXKM_RS07675 - 1627224..1628678 (+) 1455 WP_281130443.1 TIGR03752 family integrating conjugative element protein -
  ACMXKM_RS07680 - 1628691..1629089 (+) 399 WP_230268935.1 TIGR03751 family conjugal transfer lipoprotein -
  ACMXKM_RS07685 - 1629089..1631929 (+) 2841 WP_415759240.1 conjugative transfer ATPase -
  ACMXKM_RS07690 - 1631929..1632357 (+) 429 WP_230268937.1 hypothetical protein -
  ACMXKM_RS07695 - 1632347..1632664 (+) 318 WP_230268938.1 hemophilus-specific protein -
  ACMXKM_RS07700 - 1632675..1634147 (+) 1473 WP_230268939.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  ACMXKM_RS07705 - 1634174..1634530 (-) 357 WP_230268940.1 hypothetical protein -
  ACMXKM_RS07710 - 1634655..1635077 (-) 423 WP_230268941.1 hypothetical protein -
  ACMXKM_RS07715 - 1635099..1637111 (-) 2013 WP_230268942.1 integrating conjugative element protein -
  ACMXKM_RS07720 - 1637129..1638070 (-) 942 WP_230268943.1 TIGR03756 family integrating conjugative element protein -
  ACMXKM_RS07725 - 1638067..1638510 (-) 444 WP_230268944.1 TIGR03757 family integrating conjugative element protein -
  ACMXKM_RS07730 - 1638883..1639236 (+) 354 WP_230268945.1 hypothetical protein -
  ACMXKM_RS07735 - 1639309..1639554 (+) 246 WP_230268946.1 hemophilus-specific protein -
  ACMXKM_RS07740 - 1639612..1639737 (+) 126 WP_268259448.1 hypothetical protein -
  ACMXKM_RS07745 - 1639732..1641042 (-) 1311 WP_011200814.1 ISL3 family transposase -
  ACMXKM_RS07750 - 1641042..1641278 (-) 237 WP_230294061.1 hypothetical protein -
  ACMXKM_RS07755 - 1641385..1641573 (-) 189 WP_011200812.1 hypothetical protein -
  ACMXKM_RS07760 tetR(Y) 1641747..1642370 (-) 624 WP_011931118.1 tetracycline resistance transcriptional repressor TetR(Y) -
  ACMXKM_RS07765 tet(Y) 1642453..1643628 (+) 1176 WP_011931119.1 tetracycline efflux MFS transporter Tet(Y) -
  ACMXKM_RS07770 - 1643644..1643910 (-) 267 WP_052928020.1 hypothetical protein -
  ACMXKM_RS07775 - 1644078..1644425 (-) 348 Protein_1514 aminoglycoside phosphotransferase family protein -
  ACMXKM_RS07780 - 1644490..1645194 (+) 705 WP_001067858.1 IS6-like element IS26 family transposase -
  ACMXKM_RS07785 - 1645291..1645929 (+) 639 WP_096221929.1 replication protein -
  ACMXKM_RS07790 erm 1646299..1647033 (-) 735 WP_072650419.1 23S ribosomal RNA methyltransferase Erm -
  ACMXKM_RS07795 - 1647250..1647954 (+) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  ACMXKM_RS07800 - 1648169..1648474 (-) 306 WP_001255015.1 LysR family transcriptional regulator -
  ACMXKM_RS07805 floR 1648502..1649716 (-) 1215 WP_011453054.1 chloramphenicol/florfenicol efflux MFS transporter FloR -
  ACMXKM_RS07810 - 1649872..1650756 (-) 885 WP_001447541.1 DUF3363 domain-containing protein -
  ACMXKM_RS07815 - 1650787..1651728 (-) 942 Protein_1522 IS91-like element ISVsa3 family transposase -
  ACMXKM_RS07820 - 1651834..1652670 (-) 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
  ACMXKM_RS07825 aph(3'')-Ib 1652670..1653473 (-) 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
  ACMXKM_RS07830 - 1653543..1654184 (-) 642 WP_005826111.1 type A-3 chloramphenicol O-acetyltransferase CatIII -
  ACMXKM_RS07835 sul2 1654251..1655066 (-) 816 WP_001043260.1 sulfonamide-resistant dihydropteroate synthase Sul2 -
  ACMXKM_RS07840 - 1655344..1656003 (-) 660 Protein_1527 IS1595 family transposase -
  ACMXKM_RS07845 - 1656013..1656213 (-) 201 WP_230268948.1 hypothetical protein -
  ACMXKM_RS07850 - 1656247..1656459 (-) 213 WP_230268949.1 hypothetical protein -
  ACMXKM_RS07855 - 1656472..1656729 (-) 258 WP_230268950.1 hypothetical protein -
  ACMXKM_RS07860 mobH 1657089..1659068 (+) 1980 WP_230268951.1 MobH family relaxase -
  ACMXKM_RS07865 - 1659167..1659988 (+) 822 WP_405097415.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16731.47 Da        Isoelectric Point: 4.9657

>NTDB_id=1095936 ACMXKM_RS07555 WP_006248858.1 1609850..1610293(+) (ssb) [Pasteurella multocida strain 200011]
MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWNDKNTGERRELTEWHRIVFYRRQAEVCGQYLRKGSKVYIEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRNSSNGYEGQQTVNQQQTPSAPPPIPPSDNFDDDIPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=1095936 ACMXKM_RS07555 WP_006248858.1 1609850..1610293(+) (ssb) [Pasteurella multocida strain 200011]
ATGGCTGGCATCAATAAAGTCATTATTGTAGGCAACCTAGGCAATGATCCTGAAATGCGGACTATGCCTAATGGCGAAGC
AGTTGCAAATATCAGTGTAGCAACGTCAGAGTCTTGGAATGATAAAAATACCGGAGAACGCCGAGAGCTTACGGAATGGC
ACCGTATTGTGTTCTACCGCCGTCAAGCAGAAGTCTGTGGTCAATATCTACGGAAAGGTTCAAAAGTATATATAGAAGGT
CGTTTACGTACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTATACCACTGAAATTCAAGGTGATGTACTACAGAT
GCTTGATAGTCGTAACTCGTCCAATGGATATGAAGGACAGCAAACAGTCAATCAACAGCAGACTCCATCTGCTCCGCCTC
CTATACCACCTTCCGATAACTTCGATGACGATATCCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

65

100

0.796

  ssb Vibrio cholerae strain A1552

52.023

100

0.612

  ssb Neisseria meningitidis MC58

45.665

100

0.537

  ssb Neisseria gonorrhoeae MS11

45.087

100

0.531

  ssb Latilactobacillus sakei subsp. sakei 23K

31.977

100

0.374


Multiple sequence alignment