Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACLZ8E_RS03515 Genome accession   NZ_CP178726
Coordinates   778571..779038 (+) Length   155 a.a.
NCBI ID   WP_064600181.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 13.4-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 766711..805989 778571..779038 within 0


Gene organization within MGE regions


Location: 766711..805989
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLZ8E_RS03415 (ACLZ8E_03415) - 766711..767760 (-) 1050 WP_002504795.1 tyrosine-type recombinase/integrase -
  ACLZ8E_RS03420 (ACLZ8E_03420) - 767871..768068 (+) 198 WP_002497576.1 hypothetical protein -
  ACLZ8E_RS03425 (ACLZ8E_03425) - 768065..768472 (-) 408 WP_002497577.1 TIR domain-containing protein -
  ACLZ8E_RS03430 (ACLZ8E_03430) - 768466..768903 (-) 438 WP_002497578.1 DUF4231 domain-containing protein -
  ACLZ8E_RS03435 (ACLZ8E_03435) - 769015..769683 (-) 669 WP_002497579.1 hypothetical protein -
  ACLZ8E_RS03440 (ACLZ8E_03440) - 769892..771031 (-) 1140 WP_080472846.1 CapA family protein -
  ACLZ8E_RS03445 (ACLZ8E_03445) - 771077..771541 (-) 465 WP_049367112.1 ImmA/IrrE family metallo-endopeptidase -
  ACLZ8E_RS03450 (ACLZ8E_03450) - 771556..771888 (-) 333 WP_049367114.1 helix-turn-helix domain-containing protein -
  ACLZ8E_RS03455 (ACLZ8E_03455) - 772064..772309 (+) 246 WP_049367116.1 helix-turn-helix domain-containing protein -
  ACLZ8E_RS03460 (ACLZ8E_03460) - 772339..773085 (+) 747 WP_049367118.1 phage antirepressor KilAC domain-containing protein -
  ACLZ8E_RS03465 (ACLZ8E_03465) - 773127..773360 (+) 234 WP_002499262.1 MW1434 family type I TA system toxin -
  ACLZ8E_RS03470 (ACLZ8E_03470) - 773346..773684 (-) 339 WP_002499261.1 hypothetical protein -
  ACLZ8E_RS03475 (ACLZ8E_03475) - 773742..773951 (+) 210 WP_049367120.1 hypothetical protein -
  ACLZ8E_RS03480 (ACLZ8E_03480) - 773967..774113 (+) 147 WP_002502039.1 hypothetical protein -
  ACLZ8E_RS03485 (ACLZ8E_03485) - 774110..774391 (-) 282 WP_002502040.1 hypothetical protein -
  ACLZ8E_RS03490 (ACLZ8E_03490) - 774481..774672 (+) 192 WP_002502041.1 DUF1270 family protein -
  ACLZ8E_RS03495 (ACLZ8E_03495) - 774732..774995 (+) 264 WP_002502042.1 hypothetical protein -
  ACLZ8E_RS03500 (ACLZ8E_03500) - 774998..776947 (+) 1950 WP_064600172.1 AAA family ATPase -
  ACLZ8E_RS03505 (ACLZ8E_03505) - 776949..777872 (+) 924 WP_064600175.1 recombinase RecT -
  ACLZ8E_RS03510 (ACLZ8E_03510) - 777941..778570 (+) 630 WP_264080663.1 MBL fold metallo-hydrolase -
  ACLZ8E_RS03515 (ACLZ8E_03515) ssbA 778571..779038 (+) 468 WP_064600181.1 single-stranded DNA-binding protein Machinery gene
  ACLZ8E_RS03520 (ACLZ8E_03520) - 779061..780026 (+) 966 WP_064600183.1 DnaD domain-containing protein -
  ACLZ8E_RS03525 (ACLZ8E_03525) - 780045..780260 (+) 216 WP_064600186.1 DUF3269 family protein -
  ACLZ8E_RS03530 (ACLZ8E_03530) - 780315..780821 (+) 507 WP_064600190.1 dUTPase -
  ACLZ8E_RS03535 (ACLZ8E_03535) - 780787..780942 (+) 156 WP_154803512.1 hypothetical protein -
  ACLZ8E_RS03540 (ACLZ8E_03540) - 780993..781295 (-) 303 WP_064600193.1 DUF4870 domain-containing protein -
  ACLZ8E_RS03545 (ACLZ8E_03545) rinB 781400..781576 (+) 177 WP_002499244.1 transcriptional activator RinB -
  ACLZ8E_RS03550 (ACLZ8E_03550) - 781584..781733 (+) 150 WP_151507108.1 DUF1514 domain-containing protein -
  ACLZ8E_RS03555 (ACLZ8E_03555) - 781750..782196 (+) 447 WP_064600198.1 transcriptional regulator -
  ACLZ8E_RS03560 (ACLZ8E_03560) - 782780..783130 (+) 351 WP_017464444.1 HNH endonuclease -
  ACLZ8E_RS03565 (ACLZ8E_03565) - 783290..783775 (+) 486 WP_002502056.1 phage terminase small subunit P27 family -
  ACLZ8E_RS03570 (ACLZ8E_03570) - 783768..785519 (+) 1752 WP_049404235.1 terminase large subunit -
  ACLZ8E_RS03575 (ACLZ8E_03575) - 785535..785729 (+) 195 WP_002502058.1 hypothetical protein -
  ACLZ8E_RS03580 (ACLZ8E_03580) - 785729..786961 (+) 1233 WP_002502059.1 phage portal protein -
  ACLZ8E_RS03585 (ACLZ8E_03585) - 786951..787508 (+) 558 WP_064600201.1 HK97 family phage prohead protease -
  ACLZ8E_RS03590 (ACLZ8E_03590) - 787550..788887 (+) 1338 WP_064600204.1 phage major capsid protein -
  ACLZ8E_RS03595 (ACLZ8E_03595) - 788906..789247 (+) 342 WP_002502061.1 head-tail connector protein -
  ACLZ8E_RS03600 (ACLZ8E_03600) - 789237..789566 (+) 330 WP_064600206.1 hypothetical protein -
  ACLZ8E_RS03605 (ACLZ8E_03605) - 789563..789967 (+) 405 WP_064600210.1 hypothetical protein -
  ACLZ8E_RS03610 (ACLZ8E_03610) - 789972..790376 (+) 405 WP_064600212.1 hypothetical protein -
  ACLZ8E_RS03615 (ACLZ8E_03615) - 790389..791015 (+) 627 WP_064600215.1 major tail protein -
  ACLZ8E_RS03620 (ACLZ8E_03620) - 791034..791219 (+) 186 WP_049367138.1 hypothetical protein -
  ACLZ8E_RS03625 (ACLZ8E_03625) gpG 791283..791645 (+) 363 WP_002502067.1 phage tail assembly chaperone G -
  ACLZ8E_RS03630 (ACLZ8E_03630) gpGT 791678..791830 (+) 153 WP_002502068.1 phage tail assembly chaperone GT -
  ACLZ8E_RS03635 (ACLZ8E_03635) - 791859..796415 (+) 4557 WP_064600218.1 peptidoglycan DD-metalloendopeptidase family protein -
  ACLZ8E_RS03640 (ACLZ8E_03640) - 796417..797250 (+) 834 WP_049367142.1 phage tail domain-containing protein -
  ACLZ8E_RS03645 (ACLZ8E_03645) - 797260..798819 (+) 1560 WP_002502071.1 prophage endopeptidase tail family protein -
  ACLZ8E_RS03650 (ACLZ8E_03650) - 798812..798985 (+) 174 WP_002502072.1 hypothetical protein -
  ACLZ8E_RS03655 (ACLZ8E_03655) - 799001..800863 (+) 1863 WP_002502073.1 M14 family metallopeptidase -
  ACLZ8E_RS03660 (ACLZ8E_03660) - 800863..802077 (+) 1215 WP_002502074.1 BppU family phage baseplate upper protein -
  ACLZ8E_RS03665 (ACLZ8E_03665) - 802082..802705 (+) 624 WP_032606043.1 poly-gamma-glutamate hydrolase family protein -
  ACLZ8E_RS03670 (ACLZ8E_03670) - 802702..803127 (+) 426 WP_002502076.1 hypothetical protein -
  ACLZ8E_RS03675 (ACLZ8E_03675) - 803114..803521 (+) 408 WP_002502077.1 hypothetical protein -
  ACLZ8E_RS03680 (ACLZ8E_03680) - 803679..804077 (+) 399 WP_032606342.1 YxeA family protein -
  ACLZ8E_RS03685 (ACLZ8E_03685) - 804141..804551 (+) 411 WP_002497618.1 phage holin -
  ACLZ8E_RS03690 (ACLZ8E_03690) - 804526..805989 (+) 1464 WP_064600221.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 155 a.a.        Molecular weight: 17360.13 Da        Isoelectric Point: 7.0155

>NTDB_id=1091012 ACLZ8E_RS03515 WP_064600181.1 778571..779038(+) (ssbA) [Staphylococcus epidermidis strain 13.4-1]
MINRVVLVGRLTKDPEFRTTQSGIDVATFTLAVNRNFTNAQGEREADFINIIVFRKQAHNVNNYLSKGKLAGVDGRIQSR
SYENQEGRRVFVTEVVADSVQFLEPKNTQQGGQQDAYQQQTQSQTQRGQNTKPQGQNPFANANGPIDISDDDLPF

Nucleotide


Download         Length: 468 bp        

>NTDB_id=1091012 ACLZ8E_RS03515 WP_064600181.1 778571..779038(+) (ssbA) [Staphylococcus epidermidis strain 13.4-1]
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACTAAAGATCCTGAATTTAGAACAACTCAAAGTGGAATTGATGTTGC
AACTTTCACACTAGCAGTTAATCGTAATTTCACAAACGCACAGGGCGAACGTGAAGCAGATTTTATCAATATTATCGTAT
TTAGAAAACAAGCACACAATGTTAACAACTACTTATCGAAAGGAAAATTAGCAGGCGTTGATGGTCGAATTCAATCACGC
AGTTATGAAAATCAAGAAGGTCGTCGAGTATTTGTAACTGAAGTAGTTGCAGATAGCGTTCAATTTCTTGAACCTAAAAA
CACACAACAAGGTGGTCAACAAGACGCTTACCAGCAACAAACTCAATCACAAACACAACGTGGCCAAAATACTAAACCAC
AAGGACAAAATCCTTTCGCAAATGCTAATGGACCGATTGATATCAGTGATGATGATTTACCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

59.302

100

0.658

  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.574

  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

68.387

0.413

  ssb Glaesserella parasuis strain SC1401

32.402

100

0.374

  ssb Vibrio cholerae strain A1552

31.111

100

0.361


Multiple sequence alignment