Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACL6ER_RS11665 Genome accession   NZ_CP178717
Coordinates   2379452..2379826 (-) Length   124 a.a.
NCBI ID   WP_060399015.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain SY1167     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2374452..2384826
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6ER_RS11625 (ACL6ER_11625) - 2374776..2375570 (+) 795 WP_268332590.1 YqhG family protein -
  ACL6ER_RS11630 (ACL6ER_11630) sinI 2375755..2375928 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  ACL6ER_RS11635 (ACL6ER_11635) sinR 2375962..2376297 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACL6ER_RS11640 (ACL6ER_11640) tasA 2376392..2377177 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  ACL6ER_RS11645 (ACL6ER_11645) sipW 2377241..2377813 (-) 573 WP_080429111.1 signal peptidase I SipW -
  ACL6ER_RS11650 (ACL6ER_11650) tapA 2377797..2378561 (-) 765 WP_060399014.1 amyloid fiber anchoring/assembly protein TapA -
  ACL6ER_RS11655 (ACL6ER_11655) - 2378834..2379160 (+) 327 WP_029316858.1 YqzG/YhdC family protein -
  ACL6ER_RS11660 (ACL6ER_11660) - 2379202..2379381 (-) 180 WP_003236949.1 YqzE family protein -
  ACL6ER_RS11665 (ACL6ER_11665) comGG 2379452..2379826 (-) 375 WP_060399015.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACL6ER_RS11670 (ACL6ER_11670) comGF 2379827..2380210 (-) 384 WP_413324720.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACL6ER_RS11675 (ACL6ER_11675) comGE 2380236..2380583 (-) 348 WP_225514215.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACL6ER_RS11680 (ACL6ER_11680) comGD 2380567..2380998 (-) 432 WP_268276766.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACL6ER_RS11685 (ACL6ER_11685) comGC 2380988..2381284 (-) 297 WP_019258890.1 comG operon protein ComGC Machinery gene
  ACL6ER_RS11690 (ACL6ER_11690) comGB 2381298..2382335 (-) 1038 WP_225514213.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACL6ER_RS11695 (ACL6ER_11695) comGA 2382322..2383392 (-) 1071 WP_225514212.1 competence protein ComGA Machinery gene
  ACL6ER_RS11700 (ACL6ER_11700) - 2383608..2384018 (-) 411 WP_268332592.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14278.51 Da        Isoelectric Point: 10.2570

>NTDB_id=1090848 ACL6ER_RS11665 WP_060399015.1 2379452..2379826(-) (comGG) [Bacillus inaquosorum strain SY1167]
MYRSKGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKAFYTGENLLQNGALLSIRHVLEQRKGQKGSQQFTYGQVS
YHIHNTSIKEQKQISLKAITESGAERTAQLVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1090848 ACL6ER_RS11665 WP_060399015.1 2379452..2379826(-) (comGG) [Bacillus inaquosorum strain SY1167]
ATGTACCGTTCGAAAGGGTTTATTTATCCCGCTGTTCTTTTTGTCTCCGCGCTTGTGCTGCTGATCGTAAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGCGTTTTACACAGGAGAAAATTTGCTTCAGAATGGCG
CACTTCTTTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGGTTCACAGCAGTTTACATATGGGCAGGTTTCT
TATCACATTCACAATACATCGATAAAAGAGCAAAAACAAATCAGCTTAAAAGCCATTACGGAGTCGGGAGCAGAAAGAAC
TGCACAGCTAGTGTTCGATCAAAAACAGAAAAAACTGCTGCGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

82.258

100

0.823

Multiple sequence alignment