Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACL6ER_RS11630 | Genome accession | NZ_CP178717 |
| Coordinates | 2375755..2375928 (+) | Length | 57 a.a. |
| NCBI ID | WP_003226347.1 | Uniprot ID | G4NQ83 |
| Organism | Bacillus inaquosorum strain SY1167 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2370755..2380928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACL6ER_RS11615 (ACL6ER_11615) | gcvT | 2371550..2372638 (-) | 1089 | WP_003236933.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACL6ER_RS11620 (ACL6ER_11620) | - | 2373082..2374755 (+) | 1674 | WP_003236934.1 | DEAD/DEAH box helicase | - |
| ACL6ER_RS11625 (ACL6ER_11625) | - | 2374776..2375570 (+) | 795 | WP_268332590.1 | YqhG family protein | - |
| ACL6ER_RS11630 (ACL6ER_11630) | sinI | 2375755..2375928 (+) | 174 | WP_003226347.1 | anti-repressor SinI | Regulator |
| ACL6ER_RS11635 (ACL6ER_11635) | sinR | 2375962..2376297 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| ACL6ER_RS11640 (ACL6ER_11640) | tasA | 2376392..2377177 (-) | 786 | WP_003236939.1 | biofilm matrix protein TasA | - |
| ACL6ER_RS11645 (ACL6ER_11645) | sipW | 2377241..2377813 (-) | 573 | WP_080429111.1 | signal peptidase I SipW | - |
| ACL6ER_RS11650 (ACL6ER_11650) | tapA | 2377797..2378561 (-) | 765 | WP_060399014.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACL6ER_RS11655 (ACL6ER_11655) | - | 2378834..2379160 (+) | 327 | WP_029316858.1 | YqzG/YhdC family protein | - |
| ACL6ER_RS11660 (ACL6ER_11660) | - | 2379202..2379381 (-) | 180 | WP_003236949.1 | YqzE family protein | - |
| ACL6ER_RS11665 (ACL6ER_11665) | comGG | 2379452..2379826 (-) | 375 | WP_060399015.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACL6ER_RS11670 (ACL6ER_11670) | comGF | 2379827..2380210 (-) | 384 | WP_413324720.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACL6ER_RS11675 (ACL6ER_11675) | comGE | 2380236..2380583 (-) | 348 | WP_225514215.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6632.64 Da Isoelectric Point: 8.6596
>NTDB_id=1090846 ACL6ER_RS11630 WP_003226347.1 2375755..2375928(+) (sinI) [Bacillus inaquosorum strain SY1167]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1090846 ACL6ER_RS11630 WP_003226347.1 2375755..2375928(+) (sinI) [Bacillus inaquosorum strain SY1167]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
96.491 |
100 |
0.965 |