Detailed information NTG1079519

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACKPXQ_RS11870
• Genome accession: NZ_CP176038
• Coordinates: 2474753..2475190 (-)
• Length: 145 a.a.
• NCBI ID: WP_095061019.1
• Uniprot ID: A0AAP4DGY0
• Organism: Bacillus velezensis strain A4
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2469753..2480190

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACKPXQ_RS11820 (ACKPXQ_11820)	sinI	2470135..2470308 (+)	174	WP_014418369.1	anti-repressor SinI	Regulator
ACKPXQ_RS11825 (ACKPXQ_11825)	sinR	2470342..2470677 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACKPXQ_RS11830 (ACKPXQ_11830)	tasA	2470725..2471510 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACKPXQ_RS11835 (ACKPXQ_11835)	sipW	2471576..2472160 (-)	585	WP_012117977.1	signal peptidase I SipW	-
ACKPXQ_RS11840 (ACKPXQ_11840)	tapA	2472132..2472803 (-)	672	WP_014418371.1	amyloid fiber anchoring/assembly protein TapA	-
ACKPXQ_RS11845 (ACKPXQ_11845)	-	2473062..2473391 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
ACKPXQ_RS11850 (ACKPXQ_11850)	-	2473432..2473611 (-)	180	WP_003153093.1	YqzE family protein	-
ACKPXQ_RS11855 (ACKPXQ_11855)	comGG	2473668..2474045 (-)	378	WP_053284923.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACKPXQ_RS11860 (ACKPXQ_11860)	comGF	2474046..2474441 (-)	396	WP_046559876.1	competence type IV pilus minor pilin ComGF	-
ACKPXQ_RS11865 (ACKPXQ_11865)	comGE	2474455..2474769 (-)	315	WP_088056452.1	competence type IV pilus minor pilin ComGE	-
ACKPXQ_RS11870 (ACKPXQ_11870)	comGD	2474753..2475190 (-)	438	WP_095061019.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACKPXQ_RS11875 (ACKPXQ_11875)	comGC	2475180..2475488 (-)	309	WP_014418376.1	competence type IV pilus major pilin ComGC	Machinery gene
ACKPXQ_RS11880 (ACKPXQ_11880)	comGB	2475493..2476530 (-)	1038	WP_053284924.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACKPXQ_RS11885 (ACKPXQ_11885)	comGA	2476517..2477587 (-)	1071	WP_014418378.1	competence type IV pilus ATPase ComGA	Machinery gene
ACKPXQ_RS11890 (ACKPXQ_11890)	-	2477780..2478730 (-)	951	WP_014418379.1	magnesium transporter CorA family protein	-
ACKPXQ_RS11895 (ACKPXQ_11895)	-	2478876..2480177 (+)	1302	WP_029973873.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16282.81 Da
• Isoelectric Point: 10.1850

>NTDB_id=1079519 ACKPXQ_RS11870 WP_095061019.1 2474753..2475190(-) (comGD) [Bacillus velezensis strain A4]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLVVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1079519 ACKPXQ_RS11870 WP_095061019.1 2474753..2475190(-) (comGD) [Bacillus velezensis strain A4]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGTCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	54.795	100	0.552