Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACKPXQ_RS11820 | Genome accession | NZ_CP176038 |
| Coordinates | 2470135..2470308 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain A4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2465135..2475308
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACKPXQ_RS11805 (ACKPXQ_11805) | gcvT | 2465948..2467048 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACKPXQ_RS11810 (ACKPXQ_11810) | - | 2467472..2469142 (+) | 1671 | WP_038461530.1 | DEAD/DEAH box helicase | - |
| ACKPXQ_RS11815 (ACKPXQ_11815) | - | 2469164..2469958 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| ACKPXQ_RS11820 (ACKPXQ_11820) | sinI | 2470135..2470308 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| ACKPXQ_RS11825 (ACKPXQ_11825) | sinR | 2470342..2470677 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACKPXQ_RS11830 (ACKPXQ_11830) | tasA | 2470725..2471510 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACKPXQ_RS11835 (ACKPXQ_11835) | sipW | 2471576..2472160 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACKPXQ_RS11840 (ACKPXQ_11840) | tapA | 2472132..2472803 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACKPXQ_RS11845 (ACKPXQ_11845) | - | 2473062..2473391 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACKPXQ_RS11850 (ACKPXQ_11850) | - | 2473432..2473611 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACKPXQ_RS11855 (ACKPXQ_11855) | comGG | 2473668..2474045 (-) | 378 | WP_053284923.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACKPXQ_RS11860 (ACKPXQ_11860) | comGF | 2474046..2474441 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| ACKPXQ_RS11865 (ACKPXQ_11865) | comGE | 2474455..2474769 (-) | 315 | WP_088056452.1 | competence type IV pilus minor pilin ComGE | - |
| ACKPXQ_RS11870 (ACKPXQ_11870) | comGD | 2474753..2475190 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=1079516 ACKPXQ_RS11820 WP_014418369.1 2470135..2470308(+) (sinI) [Bacillus velezensis strain A4]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1079516 ACKPXQ_RS11820 WP_014418369.1 2470135..2470308(+) (sinI) [Bacillus velezensis strain A4]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |