Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACKPXQ_RS11855 Genome accession   NZ_CP176038
Coordinates   2473668..2474045 (-) Length   125 a.a.
NCBI ID   WP_053284923.1    Uniprot ID   -
Organism   Bacillus velezensis strain A4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2468668..2479045
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKPXQ_RS11815 (ACKPXQ_11815) - 2469164..2469958 (+) 795 WP_014418368.1 YqhG family protein -
  ACKPXQ_RS11820 (ACKPXQ_11820) sinI 2470135..2470308 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACKPXQ_RS11825 (ACKPXQ_11825) sinR 2470342..2470677 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACKPXQ_RS11830 (ACKPXQ_11830) tasA 2470725..2471510 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACKPXQ_RS11835 (ACKPXQ_11835) sipW 2471576..2472160 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACKPXQ_RS11840 (ACKPXQ_11840) tapA 2472132..2472803 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACKPXQ_RS11845 (ACKPXQ_11845) - 2473062..2473391 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACKPXQ_RS11850 (ACKPXQ_11850) - 2473432..2473611 (-) 180 WP_003153093.1 YqzE family protein -
  ACKPXQ_RS11855 (ACKPXQ_11855) comGG 2473668..2474045 (-) 378 WP_053284923.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACKPXQ_RS11860 (ACKPXQ_11860) comGF 2474046..2474441 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACKPXQ_RS11865 (ACKPXQ_11865) comGE 2474455..2474769 (-) 315 WP_088056452.1 competence type IV pilus minor pilin ComGE -
  ACKPXQ_RS11870 (ACKPXQ_11870) comGD 2474753..2475190 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACKPXQ_RS11875 (ACKPXQ_11875) comGC 2475180..2475488 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ACKPXQ_RS11880 (ACKPXQ_11880) comGB 2475493..2476530 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACKPXQ_RS11885 (ACKPXQ_11885) comGA 2476517..2477587 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  ACKPXQ_RS11890 (ACKPXQ_11890) - 2477780..2478730 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14072.97 Da        Isoelectric Point: 9.7163

>NTDB_id=1079518 ACKPXQ_RS11855 WP_053284923.1 2473668..2474045(-) (comGG) [Bacillus velezensis strain A4]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKAQAGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1079518 ACKPXQ_RS11855 WP_053284923.1 2473668..2474045(-) (comGG) [Bacillus velezensis strain A4]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGCCCAGGCTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment