Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | AABJ45_RS11480 | Genome accession | NZ_AP028611 |
| Coordinates | 2240416..2240541 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain Sep6 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2235416..2245541
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABJ45_RS11450 (TKY121527_22350) | - | 2236291..2236833 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| AABJ45_RS11465 (TKY121527_22360) | - | 2237380..2238333 (+) | 954 | WP_001155321.1 | IS30-like element ISSpn8 family transposase | - |
| AABJ45_RS11470 (TKY121527_22370) | comE | 2238336..2239073 (-) | 738 | WP_338372085.1 | competence system response regulator transcription factor ComE | Regulator |
| AABJ45_RS11475 (TKY121527_22380) | comD/comD2 | 2239070..2240395 (-) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| AABJ45_RS11480 | comC/comC2 | 2240416..2240541 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| AABJ45_RS11490 (TKY121527_22390) | rlmH | 2240823..2241302 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| AABJ45_RS11495 (TKY121527_22400) | htrA | 2241485..2242666 (+) | 1182 | WP_000681597.1 | trypsin-like peptidase domain-containing protein | Regulator |
| AABJ45_RS11500 (TKY121527_22410) | spo0J | 2242724..2243482 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=106635 AABJ45_RS11480 WP_000799686.1 2240416..2240541(-) (comC/comC2) [Streptococcus pneumoniae strain Sep6]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=106635 AABJ45_RS11480 WP_000799686.1 2240416..2240541(-) (comC/comC2) [Streptococcus pneumoniae strain Sep6]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |