Detailed information NTG1065148

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: ACHWS4_RS03130
• Genome accession: NZ_CP172103
• Coordinates: 629534..629986 (+)
• Length: 150 a.a.
• NCBI ID: WP_012340854.1
• Uniprot ID: W0R5B1
• Organism: Pasteurella multocida strain 682
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	620780..632503	629534..629986	within	0

Gene organization within MGE regions

Location: 620780..632503

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACHWS4_RS03080	-	620780..621001 (+)	222	WP_411835125.1	DnaB-like helicase N-terminal domain-containing protein	-
ACHWS4_RS03085	-	620947..622257 (-)	1311	WP_011200814.1	ISL3 family transposase	-
ACHWS4_RS03090	-	622257..622493 (-)	237	WP_230294061.1	hypothetical protein	-
ACHWS4_RS03095	-	622600..622788 (-)	189	WP_011200812.1	hypothetical protein	-
ACHWS4_RS03100	dnaB	622949..624193 (+)	1245	WP_411835132.1	replicative DNA helicase	-
ACHWS4_RS03105	-	624202..625848 (+)	1647	WP_012340859.1	ParB family protein	-
ACHWS4_RS03110	-	625841..626398 (+)	558	WP_012340858.1	DUF2857 domain-containing protein	-
ACHWS4_RS03115	-	626557..627747 (+)	1191	WP_014325837.1	STY4528 family pathogenicity island replication protein	-
ACHWS4_RS03120	-	627926..628684 (+)	759	WP_012340856.1	PFL_4669 family integrating conjugative element protein	-
ACHWS4_RS03125	-	628693..629178 (+)	486	WP_012340855.1	DUF3158 family protein	-
ACHWS4_RS03130	ssb	629534..629986 (+)	453	WP_012340854.1	single-stranded DNA-binding protein	Machinery gene
ACHWS4_RS03135	-	630293..630481 (+)	189	WP_011200812.1	hypothetical protein	-
ACHWS4_RS03140	-	630588..630824 (+)	237	WP_230294061.1	hypothetical protein	-
ACHWS4_RS03145	-	630824..632134 (+)	1311	WP_011200814.1	ISL3 family transposase	-
ACHWS4_RS03150	-	632165..632503 (-)	339	Protein_600	Orn/Lys/Arg decarboxylase N-terminal domain-containing protein	-

Sequence

Protein

• Length: 150 a.a.
• Molecular weight: 17204.13 Da
• Isoelectric Point: 5.2733

>NTDB_id=1065148 ACHWS4_RS03130 WP_012340854.1 629534..629986(+) (ssb) [Pasteurella multocida strain 682]
MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRYAEICGQYLRKGSKIYIEG
KLRTRKWQDQNGQERYTTEIQGELLQMLDSRNATNSVDGQQSNYQAMSQSPKATHPQDLPMDNFDDDIPF

Nucleotide

• Length: 453 bp

>NTDB_id=1065148 ACHWS4_RS03130 WP_012340854.1 629534..629986(+) (ssb) [Pasteurella multocida strain 682]
ATGGCAGGAATCAATAAAGTGATTATTGTCGGTAATCTTGGCAACGATCCTGAAATGCGGACTATGCCTAATGGTGAAGC
AGTTGCTAATATTAGTGTGGCAACTTCTGAAAGTTGGACGGATAAAAATACCGGAGAACGTCGAGAAGTCACTGAATGGC
ATCGTATCGTTTTTTATCGCCGTTATGCTGAAATTTGTGGTCAGTACCTACGTAAAGGCTCTAAAATTTATATCGAAGGA
AAATTACGGACACGTAAGTGGCAAGACCAAAACGGGCAAGAGCGTTATACAACCGAAATCCAAGGTGAACTATTACAAAT
GTTAGATAGCCGTAATGCTACAAATAGCGTAGATGGACAACAATCTAACTATCAAGCTATGAGCCAATCTCCAAAAGCAA
CACATCCACAAGATTTACCAATGGATAACTTTGATGATGATATTCCGTTCTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (4-108)

3D structure

• AlphaFold DB: W0R5B1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Glaesserella parasuis strain SC1401	63.333	100	0.76
ssb	Vibrio cholerae strain A1552	51.724	100	0.6
ssb	Neisseria gonorrhoeae MS11	45.665	100	0.527
ssb	Neisseria meningitidis MC58	45.087	100	0.52
ssbA	Bacillus subtilis subsp. subtilis str. 168	31.818	100	0.373