Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | AAA990_RS10665 | Genome accession | NZ_AP028605 |
| Coordinates | 2062766..2062891 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain Pne4 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2057766..2067891
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA990_RS10635 | - | 2058109..2059758 (-) | 1650 | Protein_2056 | YhgE/Pip domain-containing protein | - |
| AAA990_RS10640 (TKY183112_20560) | - | 2059886..2060428 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| AAA990_RS10655 (TKY183112_20570) | comE | 2060671..2061423 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| AAA990_RS10660 (TKY183112_20580) | comD/comD1 | 2061420..2062745 (-) | 1326 | WP_001853914.1 | competence system sensor histidine kinase ComD | Regulator |
| AAA990_RS10665 (TKY183112_20590) | comC/comC1 | 2062766..2062891 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| AAA990_RS10675 (TKY183112_20600) | rlmH | 2063174..2063653 (-) | 480 | WP_000695930.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| AAA990_RS10680 (TKY183112_20610) | htrA | 2063836..2065017 (+) | 1182 | WP_000681597.1 | trypsin-like peptidase domain-containing protein | Regulator |
| AAA990_RS10685 (TKY183112_20620) | spo0J | 2065075..2065833 (+) | 759 | WP_000410380.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=106171 AAA990_RS10665 WP_000799689.1 2062766..2062891(-) (comC/comC1) [Streptococcus pneumoniae strain Pne4]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=106171 AAA990_RS10665 WP_000799689.1 2062766..2062891(-) (comC/comC1) [Streptococcus pneumoniae strain Pne4]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GCTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GCTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |