Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | AAA985_RS11505 | Genome accession | NZ_AP028603 |
| Coordinates | 2191553..2191678 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain Pne2 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2186553..2196678
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA985_RS11475 | - | 2187389..2188566 (-) | 1178 | Protein_2223 | YhgE/Pip family protein | - |
| AAA985_RS11480 (TKY181970_22260) | - | 2188673..2189215 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| AAA985_RS11495 (TKY181970_22270) | comE | 2189458..2190210 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| AAA985_RS11500 (TKY181970_22280) | comD/comD1 | 2190207..2191532 (-) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| AAA985_RS11505 (TKY181970_22290) | comC/comC1 | 2191553..2191678 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| AAA985_RS11515 (TKY181970_22300) | rlmH | 2191960..2192439 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| AAA985_RS11520 (TKY181970_22310) | htrA | 2192622..2193803 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| AAA985_RS11525 (TKY181970_22320) | spo0J | 2193861..2194619 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=106014 AAA985_RS11505 WP_000799689.1 2191553..2191678(-) (comC/comC1) [Streptococcus pneumoniae strain Pne2]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=106014 AAA985_RS11505 WP_000799689.1 2191553..2191678(-) (comC/comC1) [Streptococcus pneumoniae strain Pne2]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |