Detailed information    

insolico Bioinformatically predicted

Overview

Name   prx   Type   Regulator
Locus tag   ACFKHJ_RS07980 Genome accession   NZ_CP170759
Coordinates   1542964..1543179 (-) Length   71 a.a.
NCBI ID   WP_392452339.1    Uniprot ID   -
Organism   Streptococcus parasuis strain FZ1     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1537527..1581902 1542964..1543179 within 0


Gene organization within MGE regions


Location: 1537527..1581902
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFKHJ_RS07950 - 1537527..1537994 (-) 468 WP_392452333.1 GNAT family N-acetyltransferase -
  ACFKHJ_RS07955 - 1538285..1538476 (-) 192 WP_392452335.1 helix-turn-helix domain-containing protein -
  ACFKHJ_RS07960 - 1539108..1539899 (+) 792 WP_392452337.1 helix-turn-helix domain-containing protein -
  ACFKHJ_RS07965 - 1539986..1540324 (+) 339 WP_172035965.1 DUF898 family protein -
  ACFKHJ_RS07970 - 1540552..1541409 (+) 858 WP_239604152.1 Abi family protein -
  ACFKHJ_RS07975 - 1541533..1542446 (+) 914 Protein_1539 tyrosine-type recombinase/integrase -
  ACFKHJ_RS07980 prx 1542964..1543179 (-) 216 WP_392452339.1 Paratox Regulator
  ACFKHJ_RS07985 - 1543314..1544732 (-) 1419 WP_392452341.1 peptidoglycan amidohydrolase family protein -
  ACFKHJ_RS07990 - 1544735..1545064 (-) 330 WP_392452342.1 phage holin -
  ACFKHJ_RS07995 - 1545075..1545233 (-) 159 WP_392452344.1 hypothetical protein -
  ACFKHJ_RS08000 - 1545408..1545746 (-) 339 WP_392452345.1 hypothetical protein -
  ACFKHJ_RS08005 - 1545749..1545958 (-) 210 WP_392452347.1 hypothetical protein -
  ACFKHJ_RS08010 - 1545969..1552367 (-) 6399 WP_392452349.1 phage tail spike protein -
  ACFKHJ_RS08015 - 1552364..1553155 (-) 792 WP_392452350.1 distal tail protein Dit -
  ACFKHJ_RS08020 - 1553168..1555804 (-) 2637 WP_392452352.1 hypothetical protein -
  ACFKHJ_RS08025 - 1555804..1556106 (-) 303 WP_392452353.1 hypothetical protein -
  ACFKHJ_RS08030 - 1556178..1556519 (-) 342 WP_392452355.1 tail assembly chaperone -
  ACFKHJ_RS08035 - 1556577..1557116 (-) 540 WP_392452357.1 phage major tail protein, TP901-1 family -
  ACFKHJ_RS08040 - 1557117..1557500 (-) 384 WP_392452358.1 hypothetical protein -
  ACFKHJ_RS08045 - 1557497..1557841 (-) 345 WP_392452359.1 HK97-gp10 family putative phage morphogenesis protein -
  ACFKHJ_RS08050 - 1557843..1558148 (-) 306 WP_392452361.1 hypothetical protein -
  ACFKHJ_RS08055 - 1558145..1558492 (-) 348 WP_392452362.1 phage head-tail connector protein -
  ACFKHJ_RS08060 - 1558494..1558796 (-) 303 WP_392452364.1 hypothetical protein -
  ACFKHJ_RS08065 - 1558815..1559708 (-) 894 WP_392452366.1 phage major capsid protein -
  ACFKHJ_RS08070 - 1559720..1560271 (-) 552 WP_392452368.1 DUF4355 domain-containing protein -
  ACFKHJ_RS08075 - 1560446..1560673 (-) 228 WP_392452369.1 hypothetical protein -
  ACFKHJ_RS08080 - 1560645..1560848 (-) 204 WP_312249596.1 hypothetical protein -
  ACFKHJ_RS08085 - 1560850..1561164 (-) 315 WP_392452371.1 hypothetical protein -
  ACFKHJ_RS08090 - 1561277..1562815 (-) 1539 WP_392452373.1 minor capsid protein -
  ACFKHJ_RS08095 - 1562790..1564265 (-) 1476 WP_392452375.1 phage portal protein -
  ACFKHJ_RS08100 - 1564269..1565564 (-) 1296 WP_392452376.1 PBSX family phage terminase large subunit -
  ACFKHJ_RS08105 - 1565548..1565982 (-) 435 WP_330549514.1 terminase small subunit -
  ACFKHJ_RS08120 - 1566438..1566872 (-) 435 WP_392452378.1 DUF1492 domain-containing protein -
  ACFKHJ_RS08125 - 1566956..1567300 (-) 345 WP_392452380.1 hypothetical protein -
  ACFKHJ_RS08130 - 1567302..1567607 (-) 306 WP_392452382.1 DUF1372 family protein -
  ACFKHJ_RS08135 - 1567608..1567790 (-) 183 WP_392452383.1 hypothetical protein -
  ACFKHJ_RS08140 - 1567783..1568172 (-) 390 WP_392452385.1 hypothetical protein -
  ACFKHJ_RS08145 - 1568162..1568341 (-) 180 WP_392452387.1 hypothetical protein -
  ACFKHJ_RS08150 - 1568477..1568752 (-) 276 WP_392452388.1 hypothetical protein -
  ACFKHJ_RS08155 - 1568766..1569602 (-) 837 WP_392452390.1 PD-(D/E)XK nuclease-like domain-containing protein -
  ACFKHJ_RS08160 - 1569595..1570809 (-) 1215 WP_392452392.1 DUF1351 domain-containing protein -
  ACFKHJ_RS08165 - 1570809..1571747 (-) 939 WP_392452394.1 recombinase RecT -
  ACFKHJ_RS08170 - 1571751..1571879 (-) 129 WP_392452395.1 hypothetical protein -
  ACFKHJ_RS08175 - 1571890..1572033 (-) 144 WP_392452397.1 hypothetical protein -
  ACFKHJ_RS08180 - 1572038..1572379 (-) 342 WP_392452398.1 hypothetical protein -
  ACFKHJ_RS08185 - 1572652..1573014 (-) 363 WP_392452399.1 helix-turn-helix domain-containing protein -
  ACFKHJ_RS08190 - 1573194..1573340 (-) 147 WP_392452401.1 hypothetical protein -
  ACFKHJ_RS08195 - 1573330..1573608 (-) 279 WP_392452403.1 hypothetical protein -
  ACFKHJ_RS08200 - 1573605..1573916 (-) 312 WP_392452404.1 excisionase -
  ACFKHJ_RS08205 - 1573995..1574189 (-) 195 WP_029997361.1 helix-turn-helix transcriptional regulator -
  ACFKHJ_RS08210 - 1574412..1574630 (+) 219 WP_392452406.1 hypothetical protein -
  ACFKHJ_RS08215 - 1574616..1574912 (-) 297 WP_392452408.1 hypothetical protein -
  ACFKHJ_RS08220 - 1574930..1575655 (-) 726 WP_392452410.1 phage antirepressor KilAC domain-containing protein -
  ACFKHJ_RS08225 - 1575717..1576235 (+) 519 WP_392452411.1 hypothetical protein -
  ACFKHJ_RS08230 - 1576308..1576535 (-) 228 WP_392452413.1 helix-turn-helix transcriptional regulator -
  ACFKHJ_RS08235 - 1576570..1576863 (-) 294 WP_392452415.1 ImmA/IrrE family metallo-endopeptidase -
  ACFKHJ_RS08240 - 1577037..1577834 (+) 798 WP_392452416.1 helix-turn-helix domain-containing protein -
  ACFKHJ_RS08245 - 1577888..1578313 (+) 426 WP_392452417.1 hypothetical protein -
  ACFKHJ_RS08250 - 1578319..1578789 (+) 471 WP_392452419.1 hypothetical protein -
  ACFKHJ_RS08255 - 1578908..1580050 (+) 1143 WP_392452421.1 tyrosine-type recombinase/integrase -
  ACFKHJ_RS08260 - 1580139..1580414 (-) 276 WP_024385016.1 HU family DNA-binding protein -
  ACFKHJ_RS08265 - 1580498..1581097 (-) 600 WP_277940533.1 YpmS family protein -
  ACFKHJ_RS08270 - 1581066..1581902 (-) 837 WP_277940532.1 SGNH/GDSL hydrolase family protein -

Sequence

Protein


Download         Length: 71 a.a.        Molecular weight: 8207.46 Da        Isoelectric Point: 4.8275

>NTDB_id=1059217 ACFKHJ_RS07980 WP_392452339.1 1542964..1543179(-) (prx) [Streptococcus parasuis strain FZ1]
MLEYEELKQAVDNGYTIGNKINILRRSGKIFDYVLPGEVVRPWEIVNEELVEEVMRELKKTLSRGRGVVGE

Nucleotide


Download         Length: 216 bp        

>NTDB_id=1059217 ACFKHJ_RS07980 WP_392452339.1 1542964..1543179(-) (prx) [Streptococcus parasuis strain FZ1]
ATGTTAGAATATGAAGAATTAAAACAAGCAGTGGATAATGGGTATACAATAGGAAATAAAATTAATATCTTACGCAGAAG
TGGCAAGATATTTGATTACGTTTTGCCTGGCGAGGTCGTTAGGCCTTGGGAGATTGTGAACGAGGAATTGGTGGAAGAAG
TGATGAGGGAATTAAAAAAGACCTTGTCCAGAGGTCGGGGAGTAGTCGGGGAGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

60

84.507

0.507
  prx Streptococcus pyogenes MGAS315

56.667

84.507

0.479
  prx Streptococcus pyogenes MGAS8232

55

84.507

0.465
  prx Streptococcus pyogenes MGAS315

51.667

84.507

0.437
  prx Streptococcus pyogenes MGAS315

64.286

59.155

0.38

Multiple sequence alignment