Detailed information
Overview
| Name | comC | Type | Regulator |
| Locus tag | U8955_RS10120 | Genome accession | NZ_OY769914 |
| Coordinates | 2017641..2017766 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799680.1 | Uniprot ID | - |
| Organism | Streptococcus oralis subsp. dentisani isolate Streptococcus dentisani 7746 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2012641..2022766
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U8955_RS10095 (SDENT7746_10150) | - | 2014773..2015315 (+) | 543 | WP_038804778.1 | TetR/AcrR family transcriptional regulator | - |
| U8955_RS10110 (SDENT7746_10165) | comE | 2015551..2016303 (-) | 753 | WP_000866081.1 | competence system response regulator transcription factor ComE | Regulator |
| U8955_RS10115 (SDENT7746_10170) | comD | 2016300..2017619 (-) | 1320 | WP_038804779.1 | competence system sensor histidine kinase ComD | Regulator |
| U8955_RS10120 (SDENT7746_10175) | comC | 2017641..2017766 (-) | 126 | WP_000799680.1 | competence-stimulating peptide ComC | Regulator |
| U8955_RS10130 (SDENT7746_10185) | rlmH | 2018050..2018529 (-) | 480 | WP_038804781.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4998.87 Da Isoelectric Point: 10.1884
>NTDB_id=1047571 U8955_RS10120 WP_000799680.1 2017641..2017766(-) (comC) [Streptococcus oralis subsp. dentisani isolate Streptococcus dentisani 7746]
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
MKNTVKLEQFKEVTETELQEIRGGEWRIPELIRNLIFPKRK
Nucleotide
Download Length: 126 bp
>NTDB_id=1047571 U8955_RS10120 WP_000799680.1 2017641..2017766(-) (comC) [Streptococcus oralis subsp. dentisani isolate Streptococcus dentisani 7746]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAAACAGAATTGCAGGAGATTCGGGGTGGGGAATGGAG
AATTCCAGAATTAATACGTAATCTTATTTTTCCAAAAAGAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis SK321 |
58.537 |
100 |
0.585 |
| comC/comC2 | Streptococcus pneumoniae A66 |
53.659 |
100 |
0.537 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae R6 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae G54 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae D39 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
51.22 |
100 |
0.512 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |