Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | AB8O74_RS08230 | Genome accession | NZ_CP168648 |
| Coordinates | 1732630..1733061 (-) | Length | 143 a.a. |
| NCBI ID | WP_373443333.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus paracasei strain MGL98 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1702176..1739507 | 1732630..1733061 | within | 0 |
Gene organization within MGE regions
Location: 1702176..1739507
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB8O74_RS08020 (AB8O74_08020) | - | 1702176..1703474 (-) | 1299 | WP_373443297.1 | LysM peptidoglycan-binding domain-containing protein | - |
| AB8O74_RS08025 (AB8O74_08025) | - | 1703485..1703931 (-) | 447 | WP_373443298.1 | phage holin | - |
| AB8O74_RS08030 (AB8O74_08030) | - | 1703924..1704133 (-) | 210 | WP_373443299.1 | hypothetical protein | - |
| AB8O74_RS08035 (AB8O74_08035) | - | 1704114..1704500 (-) | 387 | WP_373443300.1 | hypothetical protein | - |
| AB8O74_RS08040 (AB8O74_08040) | - | 1704521..1706878 (-) | 2358 | WP_373443301.1 | BppU family phage baseplate upper protein | - |
| AB8O74_RS08045 (AB8O74_08045) | - | 1706847..1707368 (-) | 522 | WP_373443302.1 | hypothetical protein | - |
| AB8O74_RS08050 (AB8O74_08050) | - | 1707401..1708936 (-) | 1536 | WP_373443303.1 | phage tail protein | - |
| AB8O74_RS08055 (AB8O74_08055) | - | 1708949..1709767 (-) | 819 | WP_373443304.1 | phage tail domain-containing protein | - |
| AB8O74_RS08060 (AB8O74_08060) | - | 1709771..1712518 (-) | 2748 | WP_373443305.1 | tape measure protein | - |
| AB8O74_RS08065 (AB8O74_08065) | - | 1712826..1713257 (-) | 432 | WP_373443306.1 | tail assembly chaperone | - |
| AB8O74_RS08070 (AB8O74_08070) | - | 1713321..1713953 (-) | 633 | WP_373443307.1 | phage major tail protein, TP901-1 family | - |
| AB8O74_RS08075 (AB8O74_08075) | - | 1713955..1714320 (-) | 366 | WP_373443308.1 | hypothetical protein | - |
| AB8O74_RS08080 (AB8O74_08080) | - | 1714317..1714691 (-) | 375 | WP_373443309.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AB8O74_RS08085 (AB8O74_08085) | - | 1714684..1714980 (-) | 297 | WP_373443310.1 | hypothetical protein | - |
| AB8O74_RS08090 (AB8O74_08090) | - | 1714980..1715318 (-) | 339 | WP_373443311.1 | phage head-tail connector protein | - |
| AB8O74_RS08095 (AB8O74_08095) | - | 1715318..1716196 (-) | 879 | WP_373443312.1 | hypothetical protein | - |
| AB8O74_RS08100 (AB8O74_08100) | - | 1716265..1717182 (-) | 918 | WP_373443313.1 | phage capsid protein | - |
| AB8O74_RS08105 (AB8O74_08105) | - | 1717196..1717738 (-) | 543 | WP_373443314.1 | DUF4355 domain-containing protein | - |
| AB8O74_RS08110 (AB8O74_08110) | - | 1717879..1718226 (-) | 348 | WP_373443315.1 | hypothetical protein | - |
| AB8O74_RS08115 (AB8O74_08115) | - | 1718223..1718564 (-) | 342 | WP_373443316.1 | hypothetical protein | - |
| AB8O74_RS08120 (AB8O74_08120) | - | 1718573..1719385 (-) | 813 | WP_373443317.1 | minor capsid protein | - |
| AB8O74_RS08125 (AB8O74_08125) | - | 1719309..1720829 (-) | 1521 | WP_373443318.1 | phage portal protein | - |
| AB8O74_RS08130 (AB8O74_08130) | - | 1720831..1722129 (-) | 1299 | WP_373443319.1 | PBSX family phage terminase large subunit | - |
| AB8O74_RS08135 (AB8O74_08135) | - | 1722113..1722676 (-) | 564 | WP_373443655.1 | terminase small subunit | - |
| AB8O74_RS08140 (AB8O74_08140) | - | 1722713..1723042 (-) | 330 | WP_373443320.1 | ribonucleoside-diphosphate reductase | - |
| AB8O74_RS08145 (AB8O74_08145) | - | 1723029..1724246 (-) | 1218 | WP_373443321.1 | GcrA family cell cycle regulator | - |
| AB8O74_RS08150 (AB8O74_08150) | - | 1724707..1725330 (-) | 624 | WP_016375957.1 | hypothetical protein | - |
| AB8O74_RS08160 (AB8O74_08160) | - | 1725782..1726210 (-) | 429 | WP_087911966.1 | transcriptional regulator | - |
| AB8O74_RS08165 (AB8O74_08165) | - | 1726501..1726914 (-) | 414 | WP_373443322.1 | YopX family protein | - |
| AB8O74_RS08170 (AB8O74_08170) | - | 1726911..1727180 (-) | 270 | WP_003585022.1 | hypothetical protein | - |
| AB8O74_RS08175 (AB8O74_08175) | - | 1727177..1727764 (-) | 588 | WP_373443323.1 | NUMOD4 domain-containing protein | - |
| AB8O74_RS08180 (AB8O74_08180) | - | 1727827..1728171 (-) | 345 | WP_373443324.1 | hypothetical protein | - |
| AB8O74_RS08185 (AB8O74_08185) | - | 1728168..1728509 (-) | 342 | WP_373443325.1 | hypothetical protein | - |
| AB8O74_RS08190 (AB8O74_08190) | - | 1728499..1729026 (-) | 528 | WP_373443326.1 | DUF1642 domain-containing protein | - |
| AB8O74_RS08195 (AB8O74_08195) | - | 1729023..1729286 (-) | 264 | WP_373443327.1 | hypothetical protein | - |
| AB8O74_RS08200 (AB8O74_08200) | - | 1729574..1730038 (-) | 465 | WP_373443328.1 | endonuclease | - |
| AB8O74_RS08205 (AB8O74_08205) | - | 1730051..1730416 (-) | 366 | WP_373443329.1 | endodeoxyribonuclease | - |
| AB8O74_RS08210 (AB8O74_08210) | - | 1730413..1730667 (-) | 255 | WP_161622028.1 | hypothetical protein | - |
| AB8O74_RS08215 (AB8O74_08215) | - | 1730668..1730997 (-) | 330 | WP_373443330.1 | hypothetical protein | - |
| AB8O74_RS08220 (AB8O74_08220) | - | 1730994..1731776 (-) | 783 | WP_373443331.1 | ATP-binding protein | - |
| AB8O74_RS08225 (AB8O74_08225) | - | 1731763..1732563 (-) | 801 | WP_373443332.1 | hypothetical protein | - |
| AB8O74_RS08230 (AB8O74_08230) | ssb | 1732630..1733061 (-) | 432 | WP_373443333.1 | single-stranded DNA-binding protein | Machinery gene |
| AB8O74_RS08235 (AB8O74_08235) | - | 1733058..1733717 (-) | 660 | WP_373443334.1 | ERF family protein | - |
| AB8O74_RS08240 (AB8O74_08240) | - | 1733730..1734137 (-) | 408 | WP_373443656.1 | hypothetical protein | - |
| AB8O74_RS08245 (AB8O74_08245) | - | 1734237..1734365 (-) | 129 | WP_003607017.1 | hypothetical protein | - |
| AB8O74_RS08250 (AB8O74_08250) | - | 1734368..1734694 (-) | 327 | WP_022671546.1 | hypothetical protein | - |
| AB8O74_RS08255 (AB8O74_08255) | - | 1734685..1735158 (-) | 474 | WP_373443335.1 | helix-turn-helix domain-containing protein | - |
| AB8O74_RS08260 (AB8O74_08260) | - | 1735221..1735379 (-) | 159 | WP_004562013.1 | hypothetical protein | - |
| AB8O74_RS08265 (AB8O74_08265) | - | 1735467..1735646 (+) | 180 | WP_064656585.1 | DUF1508 domain-containing protein | - |
| AB8O74_RS08270 (AB8O74_08270) | - | 1735620..1735742 (-) | 123 | WP_260642886.1 | hypothetical protein | - |
| AB8O74_RS08275 (AB8O74_08275) | - | 1735827..1736081 (+) | 255 | WP_003602808.1 | hypothetical protein | - |
| AB8O74_RS08280 (AB8O74_08280) | - | 1736256..1736510 (-) | 255 | WP_373443336.1 | helix-turn-helix transcriptional regulator | - |
| AB8O74_RS08285 (AB8O74_08285) | - | 1736637..1737320 (+) | 684 | WP_373443337.1 | S24 family peptidase | - |
| AB8O74_RS08290 (AB8O74_08290) | - | 1737338..1738171 (+) | 834 | WP_373443338.1 | DUF308 domain-containing protein | - |
| AB8O74_RS08295 (AB8O74_08295) | - | 1738293..1739507 (+) | 1215 | WP_373443657.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 16024.89 Da Isoelectric Point: 8.8813
>NTDB_id=1044685 AB8O74_RS08230 WP_373443333.1 1732630..1733061(-) (ssb) [Lacticaseibacillus paracasei strain MGL98]
MINSVALNGRLTRDVDLRYTMSGIAVGQFTLAVDRRFKSKSGNRETDFISCQIWRKSAENLANYAHKGSLIGIEGRIQTR
TYDNKQGQKIYVTEVIAENFSLLEPKPAQQTDDARVSSNRDTQGTKNQPSGKPIDVNDDDLPF
MINSVALNGRLTRDVDLRYTMSGIAVGQFTLAVDRRFKSKSGNRETDFISCQIWRKSAENLANYAHKGSLIGIEGRIQTR
TYDNKQGQKIYVTEVIAENFSLLEPKPAQQTDDARVSSNRDTQGTKNQPSGKPIDVNDDDLPF
Nucleotide
Download Length: 432 bp
>NTDB_id=1044685 AB8O74_RS08230 WP_373443333.1 1732630..1733061(-) (ssb) [Lacticaseibacillus paracasei strain MGL98]
GTGATCAATTCAGTTGCTCTTAATGGAAGATTAACAAGAGACGTCGATTTGCGTTACACCATGAGCGGAATTGCCGTTGG
ACAATTCACCTTGGCTGTTGACAGGCGTTTTAAAAGCAAAAGTGGAAATCGCGAGACAGACTTCATTAGCTGTCAGATAT
GGCGAAAATCAGCCGAAAATTTAGCAAACTACGCACACAAAGGTTCGTTGATCGGTATTGAAGGACGCATTCAAACCCGT
ACCTATGACAACAAGCAAGGGCAAAAAATTTATGTCACAGAAGTGATTGCTGAAAACTTTAGTTTGTTAGAGCCGAAGCC
AGCACAGCAGACAGATGATGCTAGAGTGTCAAGCAACCGGGACACGCAAGGCACAAAGAATCAGCCTAGCGGAAAACCGA
TTGATGTTAACGATGACGATCTTCCATTTTAA
GTGATCAATTCAGTTGCTCTTAATGGAAGATTAACAAGAGACGTCGATTTGCGTTACACCATGAGCGGAATTGCCGTTGG
ACAATTCACCTTGGCTGTTGACAGGCGTTTTAAAAGCAAAAGTGGAAATCGCGAGACAGACTTCATTAGCTGTCAGATAT
GGCGAAAATCAGCCGAAAATTTAGCAAACTACGCACACAAAGGTTCGTTGATCGGTATTGAAGGACGCATTCAAACCCGT
ACCTATGACAACAAGCAAGGGCAAAAAATTTATGTCACAGAAGTGATTGCTGAAAACTTTAGTTTGTTAGAGCCGAAGCC
AGCACAGCAGACAGATGATGCTAGAGTGTCAAGCAACCGGGACACGCAAGGCACAAAGAATCAGCCTAGCGGAAAACCGA
TTGATGTTAACGATGACGATCTTCCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.594 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
45.665 |
100 |
0.552 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.982 |
79.021 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
30.233 |
100 |
0.364 |
| ssb | Neisseria gonorrhoeae MS11 |
30.233 |
100 |
0.364 |