Detailed information
Overview
| Name | comYD | Type | Machinery gene |
| Locus tag | AB6M97_RS10180 | Genome accession | NZ_CP163514 |
| Coordinates | 2067946..2068353 (-) | Length | 135 a.a. |
| NCBI ID | WP_121835591.1 | Uniprot ID | A0A3L9DV81 |
| Organism | Streptococcus hillyeri strain S23-3001-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2068650..2107446 | 2067946..2068353 | flank | 297 |
Gene organization within MGE regions
Location: 2067946..2107446
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6M97_RS10180 (AB6M97_10180) | comYD | 2067946..2068353 (-) | 408 | WP_121835591.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AB6M97_RS10185 (AB6M97_10185) | - | 2068650..2070065 (-) | 1416 | WP_121835595.1 | peptidoglycan amidohydrolase family protein | - |
| AB6M97_RS10190 (AB6M97_10190) | - | 2070194..2070421 (-) | 228 | WP_121835597.1 | phage holin | - |
| AB6M97_RS10195 (AB6M97_10195) | - | 2070418..2070723 (-) | 306 | WP_121835599.1 | hypothetical protein | - |
| AB6M97_RS10200 (AB6M97_10200) | - | 2070727..2070867 (-) | 141 | WP_183121663.1 | hypothetical protein | - |
| AB6M97_RS10205 (AB6M97_10205) | - | 2070899..2071354 (-) | 456 | WP_121835603.1 | DUF1366 domain-containing protein | - |
| AB6M97_RS10210 (AB6M97_10210) | - | 2071351..2071536 (-) | 186 | WP_121835605.1 | hypothetical protein | - |
| AB6M97_RS10215 (AB6M97_10215) | - | 2071546..2076783 (-) | 5238 | WP_121835607.1 | phage tail spike protein | - |
| AB6M97_RS10220 (AB6M97_10220) | - | 2076780..2077571 (-) | 792 | WP_121835609.1 | distal tail protein Dit | - |
| AB6M97_RS10225 (AB6M97_10225) | - | 2077583..2080960 (-) | 3378 | WP_369350721.1 | phage tail tape measure protein | - |
| AB6M97_RS10230 (AB6M97_10230) | - | 2080979..2081242 (-) | 264 | WP_121835613.1 | hypothetical protein | - |
| AB6M97_RS10235 (AB6M97_10235) | - | 2081308..2081652 (-) | 345 | WP_121835615.1 | tail assembly chaperone | - |
| AB6M97_RS10240 (AB6M97_10240) | - | 2081705..2082235 (-) | 531 | WP_121835617.1 | phage major tail protein, TP901-1 family | - |
| AB6M97_RS10245 (AB6M97_10245) | - | 2082250..2082636 (-) | 387 | WP_121835619.1 | phage capsid protein | - |
| AB6M97_RS10250 (AB6M97_10250) | - | 2082633..2083028 (-) | 396 | WP_220702229.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AB6M97_RS10255 (AB6M97_10255) | - | 2083021..2083326 (-) | 306 | WP_121835623.1 | hypothetical protein | - |
| AB6M97_RS10260 (AB6M97_10260) | - | 2083323..2083673 (-) | 351 | WP_121835625.1 | phage head-tail connector protein | - |
| AB6M97_RS10265 (AB6M97_10265) | - | 2083688..2083954 (-) | 267 | WP_121835627.1 | hypothetical protein | - |
| AB6M97_RS10270 (AB6M97_10270) | - | 2083965..2085011 (-) | 1047 | WP_121835629.1 | major capsid protein | - |
| AB6M97_RS10275 (AB6M97_10275) | - | 2085015..2085380 (-) | 366 | WP_121835631.1 | hypothetical protein | - |
| AB6M97_RS10280 (AB6M97_10280) | - | 2085398..2086012 (-) | 615 | WP_121835633.1 | DUF4355 domain-containing protein | - |
| AB6M97_RS10285 (AB6M97_10285) | - | 2086241..2086447 (-) | 207 | WP_121835635.1 | hypothetical protein | - |
| AB6M97_RS10290 (AB6M97_10290) | - | 2086479..2086649 (-) | 171 | WP_183121664.1 | hypothetical protein | - |
| AB6M97_RS10295 (AB6M97_10295) | - | 2086646..2086888 (-) | 243 | WP_121835636.1 | hypothetical protein | - |
| AB6M97_RS10300 (AB6M97_10300) | - | 2086900..2087175 (-) | 276 | WP_183121665.1 | hypothetical protein | - |
| AB6M97_RS10305 (AB6M97_10305) | - | 2087558..2088994 (-) | 1437 | WP_121835638.1 | minor capsid protein | - |
| AB6M97_RS10310 (AB6M97_10310) | - | 2088975..2090510 (-) | 1536 | WP_121835640.1 | phage portal protein | - |
| AB6M97_RS10315 (AB6M97_10315) | - | 2090521..2091912 (-) | 1392 | WP_121835642.1 | terminase family protein | - |
| AB6M97_RS10320 (AB6M97_10320) | - | 2091909..2092361 (-) | 453 | WP_369351216.1 | terminase small subunit | - |
| AB6M97_RS10325 (AB6M97_10325) | - | 2092292..2092480 (-) | 189 | WP_369350729.1 | hypothetical protein | - |
| AB6M97_RS10330 (AB6M97_10330) | - | 2092684..2093112 (-) | 429 | WP_121835646.1 | DUF1492 domain-containing protein | - |
| AB6M97_RS10335 (AB6M97_10335) | - | 2093420..2093644 (-) | 225 | WP_121835648.1 | hypothetical protein | - |
| AB6M97_RS10340 (AB6M97_10340) | - | 2093647..2094060 (-) | 414 | WP_121835650.1 | YopX family protein | - |
| AB6M97_RS10345 (AB6M97_10345) | - | 2094044..2094298 (-) | 255 | WP_121835652.1 | hypothetical protein | - |
| AB6M97_RS10350 (AB6M97_10350) | - | 2094298..2094777 (-) | 480 | WP_121835653.1 | DUF1642 domain-containing protein | - |
| AB6M97_RS10355 (AB6M97_10355) | - | 2094779..2094952 (-) | 174 | WP_183121666.1 | hypothetical protein | - |
| AB6M97_RS10360 (AB6M97_10360) | - | 2094986..2095225 (-) | 240 | WP_121835655.1 | hypothetical protein | - |
| AB6M97_RS10365 (AB6M97_10365) | - | 2095229..2095483 (-) | 255 | WP_121835657.1 | hypothetical protein | - |
| AB6M97_RS10370 (AB6M97_10370) | - | 2095485..2095787 (-) | 303 | WP_121835659.1 | DUF1372 family protein | - |
| AB6M97_RS10375 (AB6M97_10375) | - | 2095775..2096203 (-) | 429 | WP_121835661.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AB6M97_RS10380 (AB6M97_10380) | - | 2096200..2096529 (-) | 330 | WP_121835662.1 | hypothetical protein | - |
| AB6M97_RS10385 (AB6M97_10385) | - | 2096542..2097930 (-) | 1389 | WP_121835664.1 | PcfJ domain-containing protein | - |
| AB6M97_RS10390 (AB6M97_10390) | - | 2097920..2098390 (-) | 471 | WP_121835666.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| AB6M97_RS10395 (AB6M97_10395) | - | 2098635..2099282 (-) | 648 | WP_121835668.1 | hypothetical protein | - |
| AB6M97_RS10400 (AB6M97_10400) | - | 2099282..2099599 (-) | 318 | WP_121835670.1 | hypothetical protein | - |
| AB6M97_RS10405 (AB6M97_10405) | - | 2099602..2100630 (-) | 1029 | WP_121835672.1 | DUF1351 domain-containing protein | - |
| AB6M97_RS10410 (AB6M97_10410) | bet | 2100640..2101488 (-) | 849 | WP_369350738.1 | phage recombination protein Bet | - |
| AB6M97_RS10415 (AB6M97_10415) | - | 2101485..2101664 (-) | 180 | WP_000373551.1 | hypothetical protein | - |
| AB6M97_RS10420 (AB6M97_10420) | - | 2101668..2101790 (-) | 123 | WP_281272441.1 | hypothetical protein | - |
| AB6M97_RS10425 (AB6M97_10425) | - | 2101801..2102061 (-) | 261 | WP_121835675.1 | hypothetical protein | - |
| AB6M97_RS10430 (AB6M97_10430) | - | 2102061..2102324 (-) | 264 | WP_121835677.1 | hypothetical protein | - |
| AB6M97_RS10435 (AB6M97_10435) | - | 2102521..2102847 (-) | 327 | WP_245962702.1 | HTH domain-containing protein | - |
| AB6M97_RS10440 (AB6M97_10440) | - | 2102909..2103085 (-) | 177 | WP_183121667.1 | hypothetical protein | - |
| AB6M97_RS10445 (AB6M97_10445) | - | 2103160..2103885 (-) | 726 | WP_121835681.1 | phage antirepressor KilAC domain-containing protein | - |
| AB6M97_RS10450 (AB6M97_10450) | - | 2103911..2104117 (-) | 207 | WP_121835684.1 | helix-turn-helix transcriptional regulator | - |
| AB6M97_RS10455 (AB6M97_10455) | - | 2104291..2105046 (+) | 756 | WP_121835686.1 | XRE family transcriptional regulator | - |
| AB6M97_RS10460 (AB6M97_10460) | - | 2105059..2105871 (+) | 813 | WP_121835688.1 | hypothetical protein | - |
| AB6M97_RS10465 (AB6M97_10465) | - | 2106001..2107446 (+) | 1446 | WP_121835690.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 135 a.a. Molecular weight: 14954.15 Da Isoelectric Point: 4.4944
>NTDB_id=1030380 AB6M97_RS10180 WP_121835591.1 2067946..2068353(-) (comYD) [Streptococcus hillyeri strain S23-3001-1]
MCQKLGILVSLIESLISLFIISFLAISLSGSVQGIFQDVEEKLFFLSFENIYRDSQQLAAAQKSDLQLTVTSQEISNGIT
KLSLPKSVSLLEEKILEFDTKGGNNSLAKINFVTEDETITYQLYLGSGKYQKSTT
MCQKLGILVSLIESLISLFIISFLAISLSGSVQGIFQDVEEKLFFLSFENIYRDSQQLAAAQKSDLQLTVTSQEISNGIT
KLSLPKSVSLLEEKILEFDTKGGNNSLAKINFVTEDETITYQLYLGSGKYQKSTT
Nucleotide
Download Length: 408 bp
>NTDB_id=1030380 AB6M97_RS10180 WP_121835591.1 2067946..2068353(-) (comYD) [Streptococcus hillyeri strain S23-3001-1]
CTGTGTCAGAAACTAGGAATTTTAGTATCCTTAATTGAAAGCCTTATTAGCCTTTTTATTATCAGTTTTTTAGCCATCTC
TCTTTCGGGTTCTGTGCAAGGCATTTTTCAAGATGTGGAAGAAAAGCTTTTCTTCCTCTCTTTTGAAAATATCTATCGTG
ATAGTCAACAGTTAGCTGCGGCGCAAAAAAGTGACTTGCAGTTGACTGTTACCTCACAAGAGATTAGTAATGGTATAACC
AAACTCTCTCTGCCTAAAAGCGTCAGCCTTTTAGAAGAAAAAATTCTAGAGTTTGATACCAAAGGCGGCAATAATAGCTT
AGCCAAGATAAATTTTGTAACTGAGGATGAGACAATCACCTATCAGTTGTATCTAGGGAGTGGTAAATATCAAAAATCAA
CAACTTAA
CTGTGTCAGAAACTAGGAATTTTAGTATCCTTAATTGAAAGCCTTATTAGCCTTTTTATTATCAGTTTTTTAGCCATCTC
TCTTTCGGGTTCTGTGCAAGGCATTTTTCAAGATGTGGAAGAAAAGCTTTTCTTCCTCTCTTTTGAAAATATCTATCGTG
ATAGTCAACAGTTAGCTGCGGCGCAAAAAAGTGACTTGCAGTTGACTGTTACCTCACAAGAGATTAGTAATGGTATAACC
AAACTCTCTCTGCCTAAAAGCGTCAGCCTTTTAGAAGAAAAAATTCTAGAGTTTGATACCAAAGGCGGCAATAATAGCTT
AGCCAAGATAAATTTTGTAACTGAGGATGAGACAATCACCTATCAGTTGTATCTAGGGAGTGGTAAATATCAAAAATCAA
CAACTTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYD | Streptococcus mutans UA140 |
53.6 |
92.593 |
0.496 |
| comYD | Streptococcus mutans UA159 |
53.6 |
92.593 |
0.496 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
44.8 |
92.593 |
0.415 |
| comGD/cglD | Streptococcus mitis SK321 |
44.715 |
91.111 |
0.407 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
44.715 |
91.111 |
0.407 |
| comGD/cglD | Streptococcus pneumoniae D39 |
44.715 |
91.111 |
0.407 |
| comGD/cglD | Streptococcus pneumoniae R6 |
44.715 |
91.111 |
0.407 |
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
43.902 |
91.111 |
0.4 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
43.902 |
91.111 |
0.4 |